(data stored in ACNUC7421 zone)

EMBL: CP001349.PE350

CP001349.PE350       Location/Qualifiers
FT   CDS_pept        402995..403612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0359"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="PFAM: ribosomal protein S4; RNA-binding S4 domain
FT                   protein; KEGG: met:M446_2249 RNA-binding S4
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55402"
FT                   /db_xref="GOA:B8IB09"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8IB09"
FT                   /inference="protein motif:PFAM:PF01479"
FT                   /protein_id="ACL55402.1"
FT                   /translation="MSKRIQAKHKLDRRMGQNIWGRPKSPVNRREYGPGQHGQRRKGKL
FT                   SDFGTQLRAKQKLKGYYANITEKQFRRYYAEAIRLRGDSGENLIGLLERRLDAVIYRAK
FT                   FVATPFAARQFVNHGHIKVNGQRVNIPSFLVKPGDVIEVKESSKQLEIVVVASQLAERD
FT                   VPDYIEVDHGKMTARFTRVPTLSEVPYPVHMEPNQVIEFYSR"
     atgtcgaaac gcatccaggc gaagcacaag ctcgatcgcc gcatgggcca gaacatctgg        60
     ggccgcccga agagccccgt caaccgccgc gaatacggcc ccggacagca cggacagcgc       120
     cgcaagggca agctgtccga cttcggcacg cagctgcgcg cgaagcagaa gctgaagggc       180
     tactacgcca acatcaccga gaagcagttc cgccgctact acgccgaggc gatccgcctg       240
     cgcggcgatt ccggcgagaa cctgatcggc ctcttggagc gccgcctgga cgccgtcatc       300
     taccgggcga agttcgtggc gacccccttc gcggcgcgcc agttcgtgaa ccacggccac       360
     atcaaggtga acggccagcg ggtcaatatc ccgagcttcc tcgtcaagcc gggcgacgtg       420
     atcgaggtca aggaatcctc caagcagctc gagatcgtgg tcgtggcctc ccagctcgcc       480
     gagcgcgacg tgccggacta catcgaggtc gatcacggca agatgaccgc gcgcttcacc       540
     cgcgtgccga ccctctccga ggtgccctat ccggtgcaca tggagccgaa ccaggtcatc       600
     gagttctatt cgcgctga                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page