(data stored in ACNUC7421 zone)

EMBL: CP001349.PE351

CP001349.PE351       Location/Qualifiers
FT   CDS_pept        complement(403728..404474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0360"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sen:SACE_5323 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55403"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB10"
FT                   /inference="similar to AA sequence:KEGG:SACE_5323"
FT                   /protein_id="ACL55403.1"
FT                   /translation="MGKAQSWLLRGLGVLGLLMMCAAGALALTQPAIAALACPGCYGFE
FT                   HLAGRVYVDPAMPAETRAALLEAVAEAPRRLAHFYGSPVSAPRVLACSDEACQQRIGAG
FT                   GARGVAYGSYGLRLSPRGLDRVTVLHELSHAEMVAQLGLIRSLSNDMPAWFDEGVAVLV
FT                   SNDPRDLLPEGTAVSRCRVEPGGPLPADGRDWRHSGAVDNTIYARAACRVLRWTEANGG
FT                   ASAVGRLVEAMAKGRRFPDLYRTLPE"
     atgggcaagg cgcaatcgtg gcttttgcgg ggactgggcg tccttggtct gctgatgatg        60
     tgcgctgccg gcgctttggc cctgacgcag cctgccatcg cagcgctggc ctgcccgggc       120
     tgctacggct tcgagcactt ggctggccgc gtctacgtgg atccggcgat gccggccgag       180
     acccgggcgg cgctcctcga ggccgttgcc gaagcaccgc gtcggctcgc gcatttttat       240
     ggcagcccgg tctccgcgcc gcgggtcctc gcctgctcgg acgaggcctg ccagcagcgg       300
     atcggtgccg gtggcgcgcg cggggtcgcc tacggctcct acgggctgcg gctctccccg       360
     cgcgggctgg accgggtgac cgtgctgcac gagctatccc acgccgaaat ggtggcgcag       420
     ctcgggctca tccgtagcct atccaacgat atgccggctt ggttcgacga gggcgtggcc       480
     gtgctcgtct cgaacgaccc gcgcgacctg ttgcctgaag gcacggccgt ctcgcgctgc       540
     cgggtcgagc cgggcgggcc gctccccgcc gacggccggg actggcgcca ttccggggcg       600
     gtggacaaca ccatctacgc ccgtgcggcc tgccgcgtgc tgcgctggac ggaggcgaat       660
     ggcggcgcgt cagccgtggg ccgtctggtc gaggcgatgg cgaagggaag gcgcttcccg       720
     gacctgtatc ggacgctgcc ggaataa                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page