(data stored in ACNUC7421 zone)

EMBL: CP001349.PE352

CP001349.PE352       Location/Qualifiers
FT   CDS_pept        complement(404677..405489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0361"
FT                   /product="inositol monophosphatase"
FT                   /note="PFAM: inositol monophosphatase; KEGG: met:M446_2248
FT                   inositol monophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55404"
FT                   /db_xref="GOA:B8IB11"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB11"
FT                   /inference="protein motif:PFAM:PF00459"
FT                   /protein_id="ACL55404.1"
FT                   /translation="MPSSVDARALLPQVRATVREAALLALPFFNVGERTSARVWSKSGG
FT                   SPVTEADVAVDTFLKIRLSELAPGAAWLSEETRDDPVRLDHDLVWIVDPIDGTRAFLSG
FT                   DPDWSIAIALLSGGEPVLGIVAAPVTGLVYEAVVGQGARKNGEPIRVTAPESLAGARVA
FT                   GPKPMVDHLERNLGLGGTPDALIRLRRIPSLALRVARVAEGLVDVGLISSDARDWDLAG
FT                   ADLILREAGGVVLDLAGRAPAYNRREPVHGELVAAPRAVQETLLAAMR"
     atgccctcct ccgtcgacgc gcgagcgctg cttccccagg tccgtgccac ggtccgcgag        60
     gcggccctgc tcgctctgcc cttcttcaat gtgggcgagc gcacgagcgc ccgggtctgg       120
     agcaagtccg gcggctctcc ggtgaccgag gcggatgtcg cggtcgacac cttcctgaag       180
     atccgcctca gcgaactcgc gccgggggcg gcgtggctct cggaggagac ccgcgacgat       240
     cccgtgcggc tcgaccacga cctcgtctgg atcgtggatc cgatcgacgg cacgcgggcc       300
     ttcctgtcgg gcgatcccga ctggtcgatc gccatcgcgc tcctgtccgg gggagagccg       360
     gtgctcggca tcgtggccgc cccggtgacg ggcctcgtct acgaggcggt ggtcgggcag       420
     ggcgcgcgca agaacgggga gccgatccgg gtcaccgcgc cggagagcct ggcgggtgcc       480
     cgcgttgccg ggcccaagcc gatggtcgac catctggagc ggaatctcgg cctcggcggc       540
     acccccgacg cgctgatccg gctgcggcgg attccgtccc tggcgctgcg ggtcgcccgc       600
     gtcgccgaag gtctggtcga tgtggggctg atctcgtccg acgcgcggga ctgggatctc       660
     gccggcgccg acctcatcct gcgcgaggcg ggcggcgtgg tgctcgacct cgccggccgt       720
     gccccggcct ataaccgccg ggagccggtc cacggcgaac tcgtcgccgc cccgcgcgcc       780
     gtgcaggaga ccctgcttgc ggcgatgcgc tga                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page