(data stored in ACNUC7421 zone)

EMBL: CP001349.PE353

CP001349.PE353       Location/Qualifiers
FT   CDS_pept        405848..406369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0362"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2247 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55405"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB12"
FT                   /inference="similar to AA sequence:KEGG:M446_2247"
FT                   /protein_id="ACL55405.1"
FT                   /translation="MVTRIHSTNRQTDSRKGDGLLPILHRGPVQVEPSPLPIVGRMPGA
FT                   GRAASVALCLDAEASDAAGEDRFALLLLDKDGDPLMQLGTYGDADVVAVWRRLGAETGL
FT                   PLLVIQEDGAVTPLGAQLGRVKLGAVRIRRRHGLLSGRRPRFLCRRKTGRLPLRPAVHR
FT                   DEDPLTDHGL"
     atggtcacga gaattcacag cacgaatcgg cagaccgact cacgcaaggg tgacggcctg        60
     ctgcccatcc tccaccgcgg tcccgtccag gtcgagccgt ccccgctgcc gatcgtcggc       120
     cggatgccgg gcgcgggccg cgcagccagc gtggcgctct gcctcgatgc cgaggcgagc       180
     gacgcggccg gcgaggaccg cttcgcgctc ctgctcctcg acaaggacgg cgacccgctg       240
     atgcagctcg gcacctacgg ggatgccgac gtcgtggccg tctggcggcg cctcggggcc       300
     gagaccggcc tgccgcttct ggtgatccag gaggacggcg cggtcacccc gttgggcgcg       360
     cagctcgggc gggtcaagct cggcgccgtg cgcatccgcc gtcggcacgg gctcctcagc       420
     ggacgccggc cgcgcttcct ctgccgccgc aagaccggcc ggctgccgct gcgcccggcc       480
     gtgcaccggg acgaggaccc gctgaccgac cacggcctct ga                          522
//

If you have problems or comments...

PBIL Back to PBIL home page