(data stored in ACNUC7421 zone)

EMBL: CP001349.PE354

CP001349.PE354       Location/Qualifiers
FT   CDS_pept        complement(406375..407349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0363"
FT                   /product="4-hydroxybenzoate polyprenyl transferase"
FT                   /note="TIGRFAM: 4-hydroxybenzoate polyprenyl transferase;
FT                   PFAM: UbiA prenyltransferase; KEGG: met:M446_2246
FT                   4-hydroxybenzoate polyprenyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55406"
FT                   /db_xref="GOA:B8IB13"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB13"
FT                   /inference="protein motif:TFAM:TIGR01474"
FT                   /protein_id="ACL55406.1"
FT                   /translation="MRILPKATGRKATGGPDRPVADAVSGHWVDRHAPASWRPYLRLAR
FT                   IERPIGWWLLLLPCWWSASLAAIAAGRVGPDLWHLGLFLIGAVAMRGAGSTYNDIADRD
FT                   LDARVERTRLRPLPSGRLRVRHALAFLVAQALIGLAVLLQFNRFAVVVGLFSLAPVAIY
FT                   PFMKRVMPVPQLVLGLAFAWGALMGWAALIGRLDAPALWLYAGAIAWVIGYDTIYAVQD
FT                   IEDDEIAGIKSSARFFGSQVRGAVAACFVAAVGCIAIALALAGAGLPGFLGLALFGAHL
FT                   GWQVRRLDPRNGAAALRLFRSNRDAGLILFAGLALDALWQGLA"
     gtgaggatcc tgcccaaagc gacgggtagg aaggcgacgg gagggcccga tcggccggtc        60
     gccgacgcgg tgagcggcca ttgggtcgac cggcatgcgc cggcgagctg gcgcccctac       120
     ctgcgcctcg cgcggatcga gcgtccgatc ggctggtggc tcctgctcct gccctgctgg       180
     tggtcggcct ccctcgccgc catcgcggcg ggccgggtcg ggcccgatct ctggcatctc       240
     ggcctgttcc tgatcggcgc ggtggccatg cgcggcgccg gctcgaccta caacgacatc       300
     gccgaccgcg atctcgacgc ccgcgtcgag cgcacgcgcc tgcgcccgct cccctccgga       360
     cgtctgcggg tgcgccacgc cctcgccttc ctggtggccc aggccctgat cggactggcg       420
     gtgctgctgc agttcaaccg cttcgcggtc gtggtcgggc tgttttcgct cgcgccggtg       480
     gcgatctacc ccttcatgaa gcgggtgatg ccggtgccgc agctcgtcct ggggctcgcc       540
     ttcgcctggg gggcgctgat gggctgggcg gccctgatcg gccgcctcga tgcgccggcc       600
     ctgtggctct atgcgggcgc catcgcctgg gtgatcggct acgacacgat ctacgccgtg       660
     caggacatcg aggacgatga gatcgccggc atcaaatcct cggcccgctt cttcggatcc       720
     caggtccgcg gggcggtggc cgcctgtttc gtggcggccg tcgggtgcat cgccatcgcg       780
     ctggctctgg cgggggcagg actcccgggt ttcctgggcc ttgccctgtt cggcgcgcat       840
     ctcggctggc aggtgcgccg cctcgatccc cgcaacgggg ccgcggccct gcgcctgttc       900
     cggtcgaacc gggatgccgg cctgatcctg ttcgccggcc tcgccctcga cgcgctctgg       960
     cagggcctcg cctga                                                        975
//

If you have problems or comments...

PBIL Back to PBIL home page