(data stored in ACNUC7421 zone)

EMBL: CP001349.PE355

CP001349.PE355       Location/Qualifiers
FT   CDS_pept        complement(407346..407825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0364"
FT                   /product="putative signal peptide"
FT                   /note="KEGG: mrd:Mrad2831_5383 putative signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55407"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB14"
FT                   /inference="similar to AA sequence:KEGG:Mrad2831_5383"
FT                   /protein_id="ACL55407.1"
FT                   /translation="MVRMNKRAVAVLAAGLVGAVSIGGAARAQSTDCTAIQKTLTERKD
FT                   IVAKVNSASKSKNKLTPAQACSLFTRLQANGAEGLKWISANKDWCSIPDSFAEGFKADH
FT                   TKVIGLRGKICHAAQQQAVLEKRARAQAQNGGGGGGGLLGGPGLSGSYKLPQGAL"
     atggttcgca tgaacaagcg cgccgtggcg gtgctggccg caggcttggt gggagccgtg        60
     tcgatcggtg gggctgcccg ggcccagagc acggattgca ccgcgatcca gaagaccctg       120
     accgaacgca aggacatcgt cgcgaaggtc aactcggcct cgaagagcaa gaacaagctc       180
     accccggccc aggcctgctc gctcttcacg aggcttcagg cgaacggcgc cgagggcctc       240
     aagtggatct cggccaacaa ggattggtgc tcgatcccgg attccttcgc cgaggggttc       300
     aaggccgacc acacgaaggt gatcggcctg cgcggcaaga tctgtcatgc ggctcagcag       360
     caggccgtgc tggagaagcg cgcccgcgcg caggcccaga atggcggcgg tggcggtggc       420
     ggtctcctcg gcgggcccgg cctgtccggc agctacaagc tgccgcaggg agccctgtga       480
//

If you have problems or comments...

PBIL Back to PBIL home page