(data stored in ACNUC7421 zone)

EMBL: CP001349.PE356

CP001349.PE356       Location/Qualifiers
FT   CDS_pept        408044..408847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0365"
FT                   /product="protein of unknown function DUF558"
FT                   /note="PFAM: protein of unknown function DUF558; KEGG:
FT                   met:M446_2244 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55408"
FT                   /db_xref="GOA:B8IB15"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB15"
FT                   /inference="protein motif:PFAM:PF04452"
FT                   /protein_id="ACL55408.1"
FT                   /translation="MAAYDFSAPRLFLDLPMREGMRHSLDRAQANYLLGVLRRGEGDGV
FT                   LVFNGRDGEWRAEIQPTGRKAGDLILREQTRPQTPPGNLHYLFAPLKAARLDYVAQKAV
FT                   EMGASLIRPVITRRTQGDRIKLDRLRANAIEAAEQCGILTIPEIAEAAPLPAALSALEA
FT                   ERLLVFCDEDAPVADPIMTLRQAGAGREGNGGLPLAVVIGPEGGFTPEERALILDRPNT
FT                   VRLSLGPRILRADTAAVAVLALVQAVLGDGRGSGADGRDITAPVA"
     atggcggcct acgacttcag cgctccgcgc ctgttcctcg acctgccgat gcgggagggc        60
     atgcggcaca gcctcgaccg tgcccaggcg aactacctgc tcggcgtgct gcgccggggc       120
     gagggcgacg gggttctcgt gttcaacggg cgggacggcg agtggcgggc ggagatccag       180
     ccgaccgggc gcaaggccgg cgacctcatc ctgcgcgagc agacccggcc ccagacgccg       240
     cccggcaacc tccactacct cttcgccccc ctcaaagcgg cccgcctcga ctacgtggcc       300
     cagaaggcgg tggagatggg ggcgagcctg atccggcccg tcatcacccg ccgcacgcag       360
     ggcgaccgca tcaagctcga ccggctccgc gccaacgcca tcgaggccgc cgagcaatgc       420
     ggcatcctga cgatcccgga gatcgccgag gccgcgccgc tccccgccgc cctgtcggcg       480
     ctggaggcgg agcgcctgct cgtcttctgc gacgaggatg cgcccgtggc ggatccgatc       540
     atgaccctgc ggcaggcggg cgcgggccgg gaggggaacg gggggctgcc gctcgccgtt       600
     gtgatcgggc ccgagggggg tttcacgccg gaggagcgcg ccctcatcct ggatcgcccc       660
     aacaccgtcc gcctctccct cggcccgcgg atcctgcgcg ccgacacggc tgcggtcgcc       720
     gttctcgcgc tggtgcaggc cgtcctcggc gacggccgcg gcagcggggc cgatggccgc       780
     gacatcacgg cgccggtcgc ctga                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page