(data stored in ACNUC7421 zone)

EMBL: CP001349.PE357

CP001349.PE357       Location/Qualifiers
FT   CDS_pept        408930..410063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0366"
FT                   /product="glutamate--cysteine ligase GCS2"
FT                   /note="PFAM: glutamate--cysteine ligase GCS2; KEGG:
FT                   met:M446_2243 glutamate--cysteine ligase GCS2"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55409"
FT                   /db_xref="GOA:B8IB16"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB16"
FT                   /inference="protein motif:PFAM:PF04107"
FT                   /protein_id="ACL55409.1"
FT                   /translation="MHADFAFCIEEDVFLNDAQKRDAARARVRDFLAVCRRDFPAARHD
FT                   LIEPRLIWTTPPLADLAQARRVLAELRGGIGALAATQGLAVMAAGTHPIALWSRVRPRD
FT                   TGARDRVQRDLQMVGSRTVVCGLSIRVGLPDGVSRIDVMNRIQPFLPLLLALSTSSPFW
FT                   QAQRTGLLGYRLAASRELPRSGLPPYFADEADHARYLDALMRAGAIDDLGHVWWVIRPA
FT                   PQGNALDLRIADSCTRLDDTLAIAALTRCLVRRLARDPALNRDLTGATHAITAENCWRA
FT                   QRYGIHGSFMAEEEAAMPVKEVLARTLALLAEDAAALGCTAELDLARWIVARGTSADRQ
FT                   LALFTEAQGRGLTQREALCTVVDWLSAETVGAAPTRH"
     atgcatgcgg atttcgcatt ctgcatcgaa gaggatgtct ttctcaacga cgcccagaag        60
     cgcgacgccg cccgcgcccg cgtgcgggac ttcctcgcgg tctgccgccg cgacttcccg       120
     gcggcccgcc acgacctgat cgagccccgc ctgatctgga cgacgccgcc gctcgccgat       180
     ctcgcgcagg cgcgccgggt gctcgcggag ctgcggggcg gaatcggggc gctcgccgcc       240
     acgcagggcc tcgccgtgat ggcggcgggg acccatccga tcgcgctctg gagcagggtg       300
     cgcccgcggg atacgggcgc gcgcgaccgc gtgcagcgcg acctgcagat ggtggggagc       360
     cgcacggtgg tgtgcgggct ctcgatccgc gtcggactgc ccgacggcgt gtcgcgcatc       420
     gacgtgatga accggatcca gcccttcctc ccgctcctcc ttgccctgtc cacctcctcg       480
     cccttctggc aggcgcagcg cacgggcctg ctcggctacc ggctcgcggc ctcgcgcgag       540
     ctgccccgca gcggcctgcc accctatttc gcggatgagg ccgatcacgc ccgctatctc       600
     gacgcgctga tgcgggcggg cgcgatcgac gacctcgggc atgtctggtg ggtgatccgg       660
     ccggccccgc aggggaacgc cctcgacctg cggatcgcgg atagctgcac gcgcctcgac       720
     gacacgctcg ccatcgcggc gctcacccgc tgcctcgtga ggcggctcgc gcgcgatccg       780
     gccctcaacc gggacctcac gggcgccacc catgcgatca ccgccgagaa ttgctggcgg       840
     gcgcagcgct acggcatcca tggcagcttc atggccgagg aggaggcggc catgcccgtg       900
     aaggaggtgc tcgcccgcac cctggcgctc ctggccgagg acgccgccgc cctcggctgc       960
     acggccgaac tcgacctcgc ccgctggatc gtcgcccgcg gcaccagcgc cgaccggcag      1020
     ctcgccctgt tcacggaggc gcaggggcgc ggcctgacgc agcgcgaggc gctctgcacc      1080
     gtggtcgact ggctctccgc cgagacggtc ggcgcagccc cgacccggca ctga            1134
//

If you have problems or comments...

PBIL Back to PBIL home page