(data stored in ACNUC7421 zone)

EMBL: CP001349.PE358

CP001349.PE358       Location/Qualifiers
FT   CDS_pept        complement(410361..410750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0367"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2242 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55410"
FT                   /db_xref="InterPro:IPR022254"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB17"
FT                   /inference="similar to AA sequence:KEGG:M446_2242"
FT                   /protein_id="ACL55410.1"
FT                   /translation="MDIAVEKVCEFILRVRALDVKEGPTDPDSGSNPTDDGSRDVLNED
FT                   PDDATEDELREVIAGLNDDERAELVALLYVGRGDMEPGEFADAVRLAREREAAGTSTAD
FT                   YLLGIPNVGDLLAEGLEAMGLRCEV"
     atggacatcg ccgtcgagaa ggtctgtgaa ttcatcctgc gggtgcgggc gctcgacgtg        60
     aaggaaggcc ccaccgaccc ggattcgggc tcgaacccga ccgacgacgg ctcccgcgac       120
     gtcctgaacg aggatccgga cgacgcgacc gaggacgagc tgcgcgaggt gatcgccggg       180
     ctcaatgacg acgagcgggc ggagctcgtc gcgctcctct atgtcggtcg cggcgacatg       240
     gagcccggag agttcgcgga tgccgtgcgc ctcgcccgcg agcgcgaggc agcgggcacg       300
     agcacggccg attacctcct cggcatcccg aatgtcggcg atctcctcgc ggaggggctg       360
     gaggcgatgg gattgcggtg cgaggtgtga                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page