(data stored in ACNUC7421 zone)

EMBL: CP001349.PE359

CP001349.PE359       Location/Qualifiers
FT   CDS_pept        410874..411590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0368"
FT                   /product="protein of unknown function DUF540"
FT                   /note="PFAM: protein of unknown function DUF540; KEGG:
FT                   met:M446_2241 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55411"
FT                   /db_xref="GOA:B8IB18"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB18"
FT                   /inference="protein motif:PFAM:PF04401"
FT                   /protein_id="ACL55411.1"
FT                   /translation="MLISAAFAALRQVLSPPLRRILWKSLGLTVGLLVLVWFALTRLID
FT                   TLLIGHPISAQYPIVNSFAFFLAGAGLFVALAYILPPVSILVAGYFLDDAAEVVERTDF
FT                   PDEVPGRAMALGQALLYSLRFAGLALVVNLVALALFFVPGVNLIAFFGANTYLLGREYF
FT                   EMAAARFRPLPEAQAMRRHYSATVMAAGALLAGLMVVPVLNLLTPLFGIALMVHVHKGL
FT                   SRERLLAAPQARPPIR"
     atgctcatct ccgccgcctt cgcggccctg cggcaggtgc tctccccgcc cctgcggcgc        60
     atcctgtgga agtcgctcgg cctgaccgtc gggcttctgg tgctggtctg gttcgccctc       120
     acccggctga tcgacaccct cctgatcggc cacccgatct cggcgcaata cccgatcgtc       180
     aacagcttcg cgttcttcct ggcgggcgcc gggctgttcg tggcgctggc ctacatcctg       240
     ccgccggtct cgatcctggt ggcgggctac ttcctcgatg atgccgcgga ggtggtcgag       300
     cgcaccgact ttccggatga ggtgccgggg cgggccatgg cgctcggcca agcgctcctc       360
     tactcgctgc gcttcgccgg gctcgcgctc gtcgtgaacc tcgtggcgct ggcgctcttc       420
     ttcgtgccgg gcgtgaacct gatcgccttc ttcggcgcca acacctacct gctcggccgg       480
     gagtatttcg agatggctgc cgcgcgcttc cggccgctgc cggaggcgca ggccatgcgc       540
     cgccactatt ccgcaaccgt gatggccgcg ggcgcgctgc tcgccggcct gatggtggtg       600
     ccggtgctga acctgctcac gccgctcttc ggcatcgccc tcatggtgca tgtccacaag       660
     ggtctgagcc gcgagcggct gctcgcggcc ccgcaggcgc ggccaccgat ccgctga          717
//

If you have problems or comments...

PBIL Back to PBIL home page