(data stored in ACNUC7421 zone)

EMBL: CP001349.PE36

CP001349.PE36        Location/Qualifiers
FT   CDS_pept        complement(37646..38647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0037"
FT                   /product="glycosyl transferase family 4"
FT                   /note="PFAM: glycosyl transferase family 4; KEGG:
FT                   met:M446_0035 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55088"
FT                   /db_xref="GOA:B8IT26"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT26"
FT                   /inference="protein motif:PFAM:PF00953"
FT                   /protein_id="ACL55088.1"
FT                   /translation="MSLAPLIAVPLAALAAAALILALHPLLVRYALARPNARSSHTVPT
FT                   PQGGGIAVIAAALAVAGSLWPSPFGIEAAALCLAALGLGAVGAVDDIKPLPALPRLVLQ
FT                   AVAVGGVIAASGPRLWPDLPLGLEWGLSLLAGLWFVNLVNFMDGLDWMTVAETAPVLTA
FT                   LLVFGLAGFLPPEPTLAAGALLGGVLGFAPFNRPVARLFLGDVGSLPIGLILAWLLYRL
FT                   AGEGGLAAAILLPLYYLADATLTLIRRLLAGEPVWQAHRTHYYQRATANGHRVPAVIGA
FT                   VFVLNGALALIAGATLVWPSWPVITAALALGAGLVAALLRAFATPRALTVTA"
     atgagtctcg cgccgttgat cgccgttccg ctcgccgcgc tcgccgccgc cgcgctgatc        60
     ctggccctgc acccgctcct ggtgcgctac gcgctcgcgc ggccgaacgc gcggtcgagc       120
     cacacggtgc cgacgcctca gggcggcggc atcgcggtga tcgcggcggc gcttgccgtc       180
     gccgggtcgc tatggccgtc tcccttcggg atcgaggcag ccgctttgtg ccttgcggcc       240
     ctcggccttg gcgccgtcgg cgcagtcgac gacatcaagc cgctcccggc gctgccgcgg       300
     ctcgtcctgc aggccgtcgc ggtcggcggc gtgatcgccg cctccggccc gcgcctgtgg       360
     ccggacctgc ccctcgggct cgaatggggg ctgtcgttgc tcgccgggct gtggttcgtg       420
     aacctcgtca acttcatgga cgggctcgac tggatgacgg tcgcggagac cgccccggtc       480
     ctgaccgcgc tgctcgtctt cggccttgcc gggttcctgc caccggagcc caccctggcg       540
     gccggggcgc tgctcggcgg ggtgctcggc ttcgcgccct tcaaccgccc ggtggcccgc       600
     ctcttccttg gcgatgtcgg ctcgctgccg atcgggctta tcctcgcgtg gctgctctac       660
     cgccttgccg gggagggggg cctggcggcc gcgatcctgc tgccgctcta ctatctcgcc       720
     gatgcgacgc tcacgctgat ccggcgcctg ctcgcgggcg agcccgtctg gcaggcccac       780
     cgcacgcatt actatcagcg cgccacggcg aacgggcatc gggtgccggc ggtgatcggc       840
     gcggtcttcg tgctcaacgg cgcgctggcg ctcatcgccg gcgccaccct ggtctggccg       900
     tcctggccgg tgataacggc ggcgctggcg ctcggcgccg gcctcgtcgc ggctttgctg       960
     cgcgccttcg cgacgccgcg tgctctcacg gtgaccgcat ga                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page