(data stored in ACNUC7421 zone)

EMBL: CP001349.PE360

CP001349.PE360       Location/Qualifiers
FT   CDS_pept        complement(411606..412751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0369"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /EC_number="1.6.5.3"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; NmrA family protein; Male
FT                   sterility domain; KEGG: met:M446_2240 NADH dehydrogenase
FT                   (ubiquinone)"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55412"
FT                   /db_xref="GOA:B8IB19"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB19"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACL55412.1"
FT                   /translation="MPDPVGPTRPASQLVTVFGGSGFLGRHVVRALAKRGYRIRVAVRR
FT                   PDLAQFLQPLGRVGQIVAVQANLRDAASVTRAVEHADVVINLVGILQESGNQSFQRLQA
FT                   DGAGLVARAATAIGARMIHVSAIGADPESPSAYARTKAAGEAKVLAACPEAVIFRPSII
FT                   FGPGDSFFNRFAGLARLMPVLPLAGAGTRMQPVFVGDVAEAIARTVDGKAKPGTIYELG
FT                   GPEILTLQQLVEYTLQVTKRRRIVLPLPGPAARLQARALEIADTLTLGLLPDSLKLTRD
FT                   QVILLERDNVVSEAAKAEGRSFEALGLVPTAVEAVVPGYLWRFRKAGQFSTGRGSPGMA
FT                   AVPDVIAPNPMDEHSAHHPDEAGGPAVGQKGAGTDQAPGMH"
     atgcccgacc ccgtcggccc gacccggccc gcttcgcagc tcgtgaccgt gttcggcggc        60
     tccggcttcc tgggacgcca cgtggtgcgg gcgctcgcca agcgcggcta ccgcatccgg       120
     gtcgcggtgc gccggcccga cctcgcgcag ttcctccagc ccctcgggcg cgtcggccag       180
     atcgtcgccg tgcaggcgaa cctgcgcgac gctgcctcgg tcacccgcgc ggtcgagcat       240
     gcggatgtcg tcatcaacct cgtgggcatc ctgcaggaga gcgggaacca gagcttccaa       300
     cgcctccagg cggacggggc ggggctggtc gcgcgcgcgg cgacggccat cggggcccgg       360
     atgatccatg tctcggcgat cggcgccgat cccgagtcgc cctccgccta tgcgcgcacg       420
     aaggcggccg gcgaggcgaa ggtcctggcc gcctgcccgg aggcggtgat cttccgcccg       480
     tcgatcatct tcggcccggg cgacagcttc ttcaaccgct tcgccggact ggcgcgcctg       540
     atgccggtgc tgccgctcgc cggggccggg acccgcatgc agcccgtctt cgtcggcgac       600
     gtcgcggagg cgatcgctcg cacggtcgac ggcaaggcga agccgggcac gatctacgaa       660
     ctcggcggcc ccgagatcct gaccctgcag cagctcgtcg agtacacgct gcaggtcacg       720
     aagcgccggc gcatcgtcct gcctctgccc ggtccggcgg cacgcctcca ggcacgggcg       780
     ctcgagatcg ccgacacgct caccctcggg ctcctgcccg acagcctcaa gctcacccgc       840
     gaccaggtga tcctcctgga gcgcgacaac gtcgtctccg aggcggcgaa ggcggagggg       900
     cgcagcttcg aggcgctcgg gcttgtgccg acggccgtcg aggccgtggt gcccggctat       960
     ctctggcgct tccgcaaggc gggccagttc tccaccgggc gcggcagccc cggcatggcc      1020
     gccgtgcccg acgtcatcgc accgaacccg atggacgagc actcggccca ccatccggac      1080
     gaggcgggcg gcccggcggt cggccagaag ggtgcgggca ccgatcaggc gcccggcatg      1140
     cattag                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page