(data stored in ACNUC7421 zone)

EMBL: CP001349.PE361

CP001349.PE361       Location/Qualifiers
FT   CDS_pept        complement(412943..413578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0370"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2239 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55413"
FT                   /db_xref="InterPro:IPR025833"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB20"
FT                   /inference="similar to AA sequence:KEGG:M446_2239"
FT                   /protein_id="ACL55413.1"
FT                   /translation="MTRLALPRAGGALAAVAFALLFVVQAAPAVKVALDQSRRLEAGRA
FT                   VLLAAATRDPRDLFRGEYSVLSYEAGQPAGLSASEDLARACGPEPGCRLPGGMTVYVTL
FT                   TEGADGLHHAAAIAATKPTGTNPFLRGTVRFGSLTRDGGRSPCAGLCFSGAVDYGLERW
FT                   YGPQGVPADLDRLDRGRIRIRARVDGEGTAILDALLVDGREVARTPRL"
     atgacccgcc tcgccctccc tcgtgccggc ggcgccctgg ccgccgtggc cttcgccctc        60
     ctgttcgtcg tgcaggcggc ccccgcggtg aaagtcgcgc tcgaccagtc gaggcggctc       120
     gaagccggcc gcgccgtgct cctcgcggct gccacccgag acccccggga tctgtttcgc       180
     ggcgagtaca gcgtgctgag ctacgaggcg ggtcagcccg cgggcctttc ggcctccgag       240
     gatctcgccc gggcctgcgg gccggagccg ggatgccgtc tgcccggcgg catgacggtc       300
     tatgtcacgc tcactgaggg ggcggacggc ctgcaccatg ccgcggcgat cgccgccacc       360
     aagcccaccg ggaccaaccc gttcctgcgc ggcaccgtcc ggttcgggag cctgacccgc       420
     gacggtgggc gctcgccctg cgccggcctc tgcttctccg gcgctgtcga ttacggcctg       480
     gagcgctggt acgggccgca gggtgtgccg gccgatctcg accggctcga ccgcggccgg       540
     atccgcatcc gggcccgggt ggatggcgag gggacggcta tcctcgacgc actcctcgtc       600
     gacggccgcg aggtcgctcg cacgccgcgg ctctaa                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page