(data stored in ACNUC7421 zone)

EMBL: CP001349.PE362

CP001349.PE362       Location/Qualifiers
FT   CDS_pept        complement(413575..414885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0371"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: met:M446_2238 membrane protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55414"
FT                   /db_xref="GOA:B8IB21"
FT                   /db_xref="InterPro:IPR018677"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB21"
FT                   /inference="similar to AA sequence:KEGG:M446_2238"
FT                   /protein_id="ACL55414.1"
FT                   /translation="MTDMPFSYRERVLRDIRSWAARGLIDLAQQRRLEEEVRRGSDLGG
FT                   LQVALGIAAALLVGTAALAFVASNWAAMPPFARLLLLIAADALVVGLAGLAAFRQRASG
FT                   DPTLRHIADALAALSVAVSAAALALMGQTFHLPADLSGFALTVAVVGTVTALVARSGGA
FT                   AGIAAAALVVTAWPDLDEFGPARAVSWPGWACLGLLAAGQLSGWIPARSAGFLVLLIPV
FT                   ATEIAVVGDGEPRVDAGRLVLLAFGVIALAQVLRLVPALPDRVASRLSRLAGAAAGLLL
FT                   IGLLIRAAGVTGWPSATATPSAPRLLLMAVWIGLVLLPPRLRGEPLPVGLLILAAAALV
FT                   PLCLGGPAPPILGEAGWAVWTVLLPILAVAVAARLDHRRTLYAGSLAACLVIALALMML
FT                   ADNLIGVSLHLLVAGALAALAVAAIRRLPRHAAPSWP"
     gtgaccgaca tgccgttcag ctatcgcgag cgcgtcctgc gggacatccg gtcctgggcg        60
     gcccgggggc tgatcgacct cgcccagcag cgccgcctgg aggaggaggt gcggcgcggc       120
     tcggatctcg ggggccttca ggtggcgctc ggcatcgctg ccgcgctcct cgtcggcaca       180
     gccgcgctcg ccttcgtggc ctcgaactgg gcggcgatgc cgcccttcgc acggctcctg       240
     ctgctgatcg cggccgacgc gctggtggtc gggctcgccg gcttggcggc tttccgccag       300
     cgggccagcg gcgatccgac cctgcgccac atcgccgatg ccctcgcggc gctctcggtc       360
     gcggtctcgg cggccgcgct cgcgctgatg ggccagacct tccacctgcc cgcggacctc       420
     tccggcttcg cgctcacggt ggcggtggtc ggcacggtga ctgccctcgt cgcccgctcg       480
     ggcggcgcgg cggggatcgc cgccgcggcc ctggtggtca cggcctggcc cgatctcgac       540
     gaattcggac cggcccgcgc cgtctcctgg cccggctggg cctgcctggg gcttctcgcc       600
     gccgggcagc tctccggctg gatccccgcc cggagcgcgg gcttcctcgt cctgctgatc       660
     ccggtcgcga ccgagatcgc ggtggtgggc gacggcgagc cgagggtcga tgccggccgg       720
     ctcgtgctcc tcgccttcgg ggtgatcgcg ctggcgcagg tcctccggct cgtgccggcc       780
     ctgcccgacc gggtcgcgag ccgccttagc cgcctcgcag gcgccgcagc cgggctgctg       840
     ctcatcgggc tgctgatccg cgccgccggc gtgacgggat ggccctccgc gaccgccacc       900
     ccctcggcac cccgcctgct cctcatggcg gtgtggatcg ggctcgtcct gctgccgccg       960
     cggttgcgtg gcgagcccct gccggtcggc ctcctgatcc tcgcggcggc ggcgctcgtc      1020
     ccgttgtgcc tcggcggccc ggcgccgccc atcctcggcg aggccggctg ggcggtctgg      1080
     accgtgctgc tgccgatcct cgcggtcgcg gtggcggccc ggctcgatca tcggcggacc      1140
     ctctatgccg gcagcctcgc ggcctgcctg gtcatcgccc tcgcgctgat gatgctcgcc      1200
     gacaacctga tcggcgtgtc gctccatctc ctcgtcgcgg gcgctctcgc ggcgctcgcc      1260
     gtggcggcga tccgccgtct cccgcgccat gctgccccga gctggccatg a               1311
//

If you have problems or comments...

PBIL Back to PBIL home page