(data stored in ACNUC7421 zone)

EMBL: CP001349.PE363

CP001349.PE363       Location/Qualifiers
FT   CDS_pept        415221..416303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0373"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: nha:Nham_4120 transposase IS116/IS110/IS902"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55415"
FT                   /db_xref="GOA:B8IB22"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB22"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ACL55415.1"
FT                   /translation="MLSGHKHREGAAVKYYAGLDVSLEETAICVVDDTGRIVREARAAS
FT                   EPGALVQALNQIGLPLERIGLEACSLTAWLHDGLREAGLPAICIETRQANAAMKTMPNK
FT                   TDRNDARALAQIMRTGWFRQVHVKSRQCRLWRSLLVARRTVLNEMRSIENVVRGILREA
FT                   GLKLGTPGRAAFAGRVRELAEGVPLMTQLVEPLLEVLASMLTALAGLTKQVMDLVKKEA
FT                   VCQRLMSVPGVGPITALAFRATIDRPDRFRRSRDVGAHLGLTPARYQSGETDIQGKISR
FT                   CGDELARTALYEAAHTLLVRSQKWSSLRAWGMKIARRRGMARARVAVARKLAVILHRMW
FT                   SDGTAFRWGKEPAEGATLAG"
     gtgttgagcg gccacaagca tcgggaagga gcagccgtga agtattatgc cggactggac        60
     gtttcgctgg aagagaccgc gatctgcgtt gtcgacgata cgggtcggat cgtgcgggag       120
     gcgcgggcgg cgagtgagcc tggcgcgctg gtgcaggcgc tgaaccagat cggcctgccc       180
     ctggagcgca tcggcctgga agcgtgctcg ctgacggcct ggctgcacga cggcctgcgc       240
     gaggcgggct tgccggcgat ctgcatcgag acgcgccagg ccaatgccgc gatgaagacg       300
     atgcccaaca agaccgaccg caacgacgca cgcgccctgg cgcagatcat gcggacgggc       360
     tggttccggc aggtccatgt caagagccgt cagtgccggc tgtggcgttc gctgctggtg       420
     gcgcgccgca cggtgctcaa cgagatgcgt tcgatcgaga acgtggtgcg ggggatcctg       480
     cgcgaagccg ggctcaagct cggcacgcct ggccgtgcag ccttcgccgg ccgcgtacgc       540
     gaactggccg agggcgtgcc cctgatgacg cagctcgtcg aaccgctcct ggaggtgctg       600
     gccagcatgc tgaccgcact cgccggcttg acgaagcagg tcatggatct cgtcaagaaa       660
     gaggcggtct gccagcggct gatgagcgtg ccgggcgtcg gccccatcac cgcgcttgcc       720
     ttccgggcga cgatcgaccg gcccgaccgg ttcaggcgct cgcgcgacgt cggcgcccat       780
     ctcggtctga cgccggcgcg ctaccagtcc ggcgagaccg acatccaggg caagatcagc       840
     cgttgcggcg acgaactcgc gcgcaccgcg ctctacgagg cggcgcatac gctgctggtg       900
     cggagccaga aatggtcgag cctgcgcgcc tgggggatga agatcgccag gcgtcgcggc       960
     atggcccgcg cccgcgtcgc ggtcgcccgc aagctcgccg tcatcctcca tcgcatgtgg      1020
     agcgacggca ccgcgttccg ctggggtaag gagcccgcag agggtgccac gctcgcagga      1080
     tga                                                                    1083
//

If you have problems or comments...

PBIL Back to PBIL home page