(data stored in ACNUC7421 zone)

EMBL: CP001349.PE364

CP001349.PE364       Location/Qualifiers
FT   CDS_pept        complement(416795..418297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0374"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; FAD dependent oxidoreductase;
FT                   KEGG: met:M446_2236 amine oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55416"
FT                   /db_xref="GOA:B8IB23"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB23"
FT                   /inference="protein motif:PFAM:PF01593"
FT                   /protein_id="ACL55416.1"
FT                   /translation="MSLHTETLIIGAGPAGLTAAYLLAKAGRQVTVLERDPLRVGGISR
FT                   TVEYNGYLFDIGGHRFFSKSKEVVDLWNEILPDDFIERPRLSRIYYKGRYYAYPLKAFE
FT                   ALRNLGLWQSAACIASYLYARARPVREPRSFHDWVRNQFGERLFSIFFKTYTEKVWGLS
FT                   CDAISADWAAQRIKGLDLGAAIRDALTRSLGLRGRPKAGEPVIKTLIESFRYPRRGPGM
FT                   MWEAAAAAVRDGGGRVLLGLGVESLSFDPGCGLWTIGARRQDGSRETFTARHVVSSAAI
FT                   QDLVAALRPAPLSTFHARALGYRDFITVALIARGAEDFLDNWIYIHDPSVKVGRVQNFR
FT                   SWSPEMVPDPTYTCLGLEYFCFEGDGLWNAADSELVDLAKREIAQIGLIRPEDVVDACV
FT                   VRQPKAYPVYDEAYRDNVAAIRRDLETTYPTLHLVGRNGMHKYNNQDHAMMTAMLTVRN
FT                   ILAGQRLYDVWSVNEDAEYAEAGLSGAREALRSERLVPRKVA"
     atgagcctgc acaccgagac gctgatcatc ggcgccggac cggctggttt gactgccgcc        60
     tatctcttgg caaaggccgg gcgtcaggtc accgtgttgg aacgtgatcc gctgcgcgtc       120
     ggcggtatca gccgcacggt cgaatacaac ggctatctct tcgacatcgg cggtcaccgt       180
     ttcttctcga aatcgaagga agtggtggac ctctggaacg agatcctgcc ggacgacttc       240
     atcgagcggc cgcgcctgtc ccggatctac tacaagggcc ggtactacgc ctatccgctc       300
     aaggcgttcg aggctctgcg caacctcggc ctgtggcaga gcgcggcctg catcgcctcc       360
     tacctctacg cccgcgcccg gcctgtgcgg gagccgagga gcttccacga ctgggtgcgc       420
     aaccagttcg gcgagcgcct gttctcgatc ttcttcaaga cctacaccga gaaggtgtgg       480
     ggcctatcct gcgatgcgat ctcggccgat tgggcggccc agcgcatcaa gggcctcgat       540
     ctcggtgccg cgatccgcga tgcgctgacc cgctcgctcg gtctgcgcgg taggccgaag       600
     gccggcgagc cggtgatcaa gaccctcatc gaatccttcc gctatccgcg gcggggcccc       660
     ggcatgatgt gggaggccgc cgcggcggcg gtgcgcgacg gcggcggccg ggtgctcctc       720
     ggcctagggg tcgagagcct gtccttcgac cctggctgcg gcctctggac catcggcgcc       780
     cgccggcagg acggctcccg ggagaccttc acggcccgcc atgtcgtctc ctcggcggcg       840
     atccaggatc tggtggcggc cctccggccc gccccgctca gcaccttcca cgcccgcgcc       900
     ctcggctacc gggatttcat caccgtggcg ctcatcgccc gcggcgccga ggatttcctc       960
     gacaactgga tctacatcca cgatccgagc gtgaaggtgg ggcgggtgca gaacttccgc      1020
     tcctggtcgc ccgagatggt gccggacccg acctatacct gcctcgggct ggaatatttc      1080
     tgcttcgagg gcgacgggct gtggaatgcg gcggattccg agctcgtcga cctcgccaag      1140
     cgcgagatcg cgcagatcgg gctgatccgg ccggaggatg tggtcgatgc ctgcgtggtg      1200
     cgccagccca aggcctatcc ggtctatgac gaggcctacc gggacaacgt ggcggcgatc      1260
     cgccgcgacc tggagaccac ctacccgacg ctccacctcg tcggccgcaa cggcatgcac      1320
     aagtacaaca accaggacca cgccatgatg accgcgatgc tcaccgtgcg gaacatcctg      1380
     gcgggccagc gcctctacga cgtctggagc gtgaacgagg acgccgaata cgccgaggcg      1440
     ggcctgtcgg gggcgcgcga ggcgctccgg agcgagcggc tggtgccgcg caaggtggcg      1500
     tag                                                                    1503
//

If you have problems or comments...

PBIL Back to PBIL home page