(data stored in ACNUC7421 zone)

EMBL: CP001349.PE365

CP001349.PE365       Location/Qualifiers
FT   CDS_pept        418446..420260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0375"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2235 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55417"
FT                   /db_xref="GOA:B8IB24"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB24"
FT                   /inference="similar to AA sequence:KEGG:M446_2235"
FT                   /protein_id="ACL55417.1"
FT                   /translation="MPSTALLAAGPSPAPRSLFESRPVLWGLVALGLAGAFGLSHMLPV
FT                   LRDLVLPDTDDAMRLVQVRDLLAGQSWFDVGQHRLLPPGGSSMHWSRLVDLPIAALILI
FT                   LRPFAGAQADAVAAALWPPLLFGLYSAMLFVGARRLSGERAALLALFAATQTPLLTSLF
FT                   APGRIDHHNVQVCAVLGLALCLMRPAPGWREGAAAGALAALSLAVGLETLPFIAAAGLL
FT                   VTGAWILSGERALGAFLGFAAALAAGSAALFGLGTTPAHWGAPACDALSPPWLWVAGSA
FT                   GATALAAAGLRRRLLRPETRLALAALGGLAIAGGFAAIAPACLDGPFAGMPETIRQGWL
FT                   LKVREMLPLWRNLPEFPGEILSAFMPLLVGALAATVLALRGPAAQRRPQGILAAALWLG
FT                   VGLGTLQFRGLYVASGFVALAAGAVLDRGLAMLRTPGAGHAARAATLAAGLGLIGKLWL
FT                   AGAAVPSLPSPTKPQAGNGESTWSHCTGRSAMAALAAQPPGTVLAPIDLGPFLLLHTPH
FT                   GVVAAPYHRNTVGLAAALEGFRDAAALRRVAAERQVAYIAVCPPSEGADGGAPLIGDLA
FT                   RRKVAPSWLEPIPMPDSPLKIWRVRPQP"
     atgccgagca ctgccctcct cgccgcgggg ccaagtcctg ccccgcgctc cctgttcgag        60
     agccggccgg tgctatgggg cctggtggct ttggggctcg ccggggcctt cgggctgtcg       120
     cacatgctgc cggtgctgcg cgacctcgtc ctgcccgaca ccgacgacgc catgcgcctc       180
     gtgcaggtgc gcgatctcct cgccgggcaa tcgtggttcg atgtcggcca gcaccgcctg       240
     ctgccccccg gcgggtcctc gatgcactgg tcccgcctcg tcgatctgcc catcgccgcg       300
     ctgatcctca tcctgcggcc attcgccggg gcacaggcgg atgccgtcgc ggccgcgctc       360
     tggccgcccc tcctgttcgg cctctactcc gccatgctgt tcgtcggcgc gcgccggctg       420
     tccggcgagc gggctgccct cctcgccctg ttcgccgcca cccagacccc gctgctgacc       480
     tccctgttcg cgccgggccg catcgaccac cacaacgtgc aggtctgcgc cgtgctcggc       540
     ctcgccctct gcctgatgcg cccggctccg ggctggcgcg agggcgccgc cgcgggtgcg       600
     ctcgccgcgc tctccctggc ggtcggtctg gagacgctgc cgttcatcgc cgcggcggga       660
     ttgctcgtca ccggggcctg gatcctgtcc ggggagcgcg ctctcggggc gttcctgggc       720
     ttcgcggccg cgctggcggc cggcagcgcc gccctgttcg ggctcgggac gacgccggcc       780
     cattggggcg cgccggcctg cgatgcgctg tcgccgccct ggctctgggt cgccggcagc       840
     gccggcgcca cggcgcttgc ggccgcgggg ctgcgccggc gccttctccg cccggagacc       900
     cggctcgccc tggccgccct cggcggcctt gcgatcgcgg gcggattcgc cgcgatcgcc       960
     ccggcctgtc tcgacggccc cttcgcgggc atgcccgaga caatccgcca gggctggctc      1020
     ctcaaagtcc gcgagatgct gccgctgtgg cggaacctgc ccgagttccc gggcgagatc      1080
     ctgtccgcct tcatgccgct cctcgtcggg gcgctggccg cgaccgtcct cgccctgcgc      1140
     ggaccggccg cgcagcgccg gcctcaaggg atcctggcgg cggcgctctg gctcggcgtg      1200
     ggtctcggca ccctgcagtt ccgcggcctc tacgttgcct caggcttcgt cgcgctcgcc      1260
     gccggcgcgg tgctggatcg ggggctggcg atgctgcgga cgccgggagc gggtcacgcc      1320
     gcgcgggccg cgaccctggc cgcaggattg gggctgatcg gcaagctctg gctcgcgggc      1380
     gccgccgtgc cgagcctccc gagccccacc aagccccaag cggggaatgg cgagtccacc      1440
     tggtcgcact gcaccggccg ctccgccatg gcggccttgg ccgcgcagcc gcccggaacc      1500
     gtgctggcgc cgatcgatct cggcccgttc ctcctgctcc acacgccgca cggcgtcgtg      1560
     gcagccccgt accatcgcaa caccgtcggg ctcgcggcgg cgctcgaggg atttcgcgac      1620
     gcggcggcgc tgcgccgggt ggcagcggag cggcaggtcg cctacatcgc ggtctgcccg      1680
     ccatccgagg gtgcggatgg cggcgcgccg ctcatcggcg accttgcccg ccgcaaggtt      1740
     gcgccgtcct ggctggagcc gatcccgatg cctgactccc ccctcaagat ctggcgcgtc      1800
     cgcccgcagc cgtga                                                       1815
//

If you have problems or comments...

PBIL Back to PBIL home page