(data stored in ACNUC7421 zone)

EMBL: CP001349.PE366

CP001349.PE366       Location/Qualifiers
FT   CDS_pept        420257..420790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0376"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2234 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55418"
FT                   /db_xref="InterPro:IPR010865"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB25"
FT                   /inference="similar to AA sequence:KEGG:M446_2234"
FT                   /protein_id="ACL55418.1"
FT                   /translation="MRQRAPIAILLAALGLTLLALGGLVVARGAEPGGIEEAWMLLFGA
FT                   PDLGPVDFEHLRRSGADGLACPPDICPGAHADIVPPTLPIAGARLREIVRRVAQGEPDT
FT                   VLVFSDRWGEQDRYVARSRIMRFPDTVTVEIVGRGEGASTLALYSRSQIGAGLFSDNRA
FT                   RLARWLDGVKDAAR"
     gtgaggcagc gggcgccgat cgccatcctt ctggccgcgc tcggcctcac cctcctggcg        60
     ctgggcgggc tcgtcgtggc gaggggggcg gagcccggcg gcatcgagga ggcctggatg       120
     ctgctgttcg gcgcgcccga tctcgggccg gtcgatttcg aacacctgcg ccgctccggc       180
     gccgacggcc tcgcctgtcc cccggacatc tgccccggcg cacacgcgga tatcgtgccg       240
     ccgaccttac ccatcgcggg cgcgcgcctg cgcgagatcg tgcgccgcgt cgcccagggc       300
     gagccggaca ccgtcctggt cttctcggac cgctgggggg agcaggaccg ctacgtggcg       360
     cgatcccgaa tcatgcgatt tcccgatacg gtgacggtcg agatcgtcgg gcgcggcgag       420
     ggcgcctcca ccctcgcgct ctattcccgc agccagatcg gcgccggcct gttcagcgac       480
     aaccgcgccc gccttgcccg ctggctggac ggcgtgaagg atgcggcacg atga             534
//

If you have problems or comments...

PBIL Back to PBIL home page