(data stored in ACNUC7421 zone)

EMBL: CP001349.PE367

CP001349.PE367       Location/Qualifiers
FT   CDS_pept        420787..422160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0377"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; KEGG: met:M446_2233 amine
FT                   oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55419"
FT                   /db_xref="GOA:B8IB26"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB26"
FT                   /inference="protein motif:PFAM:PF01593"
FT                   /protein_id="ACL55419.1"
FT                   /translation="MRAPDHARFRPHTVPPLAPLPREPDVVVVGAGAAGIAAARRLRAR
FT                   GLSVAVLEARDRVGGRTFTTTLRGHAVDLGAHWLHAGPINPLVAFGVARGEPLRRAAQE
FT                   SHLMVGRRKGRPDEAAAYGRAFALADRAMTGGAGRDGPDRPAAFALPPGLGPWGRRVAL
FT                   VHGLVSGRPLAEVSLHDFPSMEYGDNFFIAGGYGAYLARLARALPITLGAPVRVIDWSG
FT                   AGVAVDVGGRGRIRARAVLVTAPMMVLQDEAAFRFSPPLPPGIRAAIDGFLPGIYEHVV
FT                   LHWPSAPFRGRDRLAGLTGGRRQPPGLLTRVDGTAFHYFELDRPMTAALDAAGAGPDGA
FT                   RRLTRAVLTDHVGSGRLGDLAIPAVSEWRLDPWSRGSWAVVPPGHAPARDALKEPVGER
FT                   IWFAGEALSRRQWGTAGGAYEEGERAAEAIAAALAGSRAGEAKRAREPRDPLSRAGEG"
     atgagagcac cggatcacgc gcggtttcgc ccgcacaccg tcccgccgct ggccccgctg        60
     ccgcgcgagc ccgacgtggt ggtggtgggg gcgggcgccg cgggcattgc ggcggcgcgg       120
     cggctgcgcg cgcgcggcct ttcggtcgcc gtgctggagg cccgcgaccg cgtcggcggg       180
     cgaaccttca ccacgaccct gcgcgggcac gcggtcgatc tcggcgccca ttggctccat       240
     gccgggccga tcaatcccct ggtggcgttc ggcgtcgcgc ggggcgagcc gctgcggcgc       300
     gccgcccagg agagccacct gatggtgggg cggcgcaagg ggcggcccga cgaggcggcg       360
     gcctacggga gggccttcgc gctggccgac cgggccatga cgggcggcgc cggacgggac       420
     ggccccgatc gccccgccgc cttcgccctg ccgccgggtc tcgggccgtg gggacggcgc       480
     gttgccctgg tgcacgggct cgtctcgggc cggccgctcg cggaggtgag cctgcacgac       540
     ttccccagca tggagtacgg ggacaatttc ttcatcgcgg gtggctacgg cgcctatctg       600
     gcgcgcctgg cccgggcgct tccgatcacg cttggcgcgc ccgtccgggt catcgactgg       660
     tcgggagccg gggtcgcggt ggatgttggc ggccggggcc ggatccgggc gcgcgccgtc       720
     ctcgtcacgg cgcccatgat ggtgctgcag gacgaggccg ccttccgctt ctcccctccc       780
     ctgccaccgg gcatccgagc ggcgatcgac ggtttcctgc ccggcatcta cgagcacgtg       840
     gtgctgcatt ggccctcggc gcccttccgc gggcgcgatc ggctcgcggg cctcacgggc       900
     gggcggcgcc agcccccggg cctcctcacc cgcgtcgacg gcacggcctt ccactatttc       960
     gagctcgacc ggccgatgac tgcggcgctc gatgcggccg gggcggggcc ggacggcgcg      1020
     cgacgcctca cccgcgccgt cctgaccgat catgtcggct ccggccgcct cggcgacctc      1080
     gccatcccgg ccgtcagcga gtggcgcctc gatccctggt cgcgcgggtc ctgggccgtg      1140
     gtgccgccgg gccacgcccc cgcgcgcgac gccctcaagg agccggtggg cgagcggatc      1200
     tggtttgccg gcgaggccct gtcgcgtcgg caatggggca cggcgggcgg cgcctacgag      1260
     gagggcgagc gggccgccga ggcgatcgcc gcggccctgg ccgggagccg ggccggagag      1320
     gcgaagaggg cgcgggaacc gcgggatccc ctctcccgtg cgggagaggg gtag            1374
//

If you have problems or comments...

PBIL Back to PBIL home page