(data stored in ACNUC7421 zone)

EMBL: CP001349.PE368

CP001349.PE368       Location/Qualifiers
FT   CDS_pept        complement(422329..423333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0378"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /EC_number="1.1.1.26"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase NAD-binding; KEGG: met:M446_2232 glyoxylate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55420"
FT                   /db_xref="GOA:B8IB27"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB27"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ACL55420.1"
FT                   /translation="MSSLKRKPLVVVTRRLPDVVETRMRELFDTRLNHDDKPLSPAALV
FT                   QAVQEADVLVPTLTDEIDASLLAQAGPQLRLIANFGNGVDHIDVDSALQRGITVTNTPG
FT                   VLTEDTADMTMALILAVARRITEGARIIPEESWTTGWSPTWMLGRRITGKRLGIVGMGR
FT                   IGQALARRARAFGLSIHYHNRRRVSARTEAELEATYWESLDQMLARVDIVSVNCPHTPA
FT                   TYHLLSARRLKLLKPEAVVVNTARGEVIDETALARLIEVGDIAGAGLDVFEQEPAVSPR
FT                   LVKLAKAGKVVLLPHMGSATHESRIDMGEKVIINIKTFMDGHRPPDRVLPSML"
     atgtcgtcgt tgaagcgcaa gccgctcgtg gtggtgaccc ggcgcctgcc ggacgtggtg        60
     gagacgcgca tgcgcgagct cttcgacacg cgcctcaacc acgacgacaa gcccctctcg       120
     cccgccgccc tcgtgcaggc cgtgcaggag gcggacgtgc tcgtccccac cctgacggac       180
     gagatcgacg cctccctgct ggcccaggcc ggcccgcagc tccggctgat cgccaatttc       240
     ggcaacggcg tcgatcacat cgacgtcgac agcgccctcc agcgcggcat cacggtcacg       300
     aacacgccgg gcgtgctgac cgaggacacg gccgacatga cgatggcgct gatcctcgcg       360
     gtggcccgcc ggatcaccga gggcgcgcga atcatcccgg aggagtcctg gaccaccggc       420
     tggtcgccga cctggatgct ggggcggcgg atcaccggca agcgcctcgg catcgtcggc       480
     atgggccgca tcggccaagc gctggcgcgc cgcgccaggg ccttcggact ctcgattcac       540
     tatcacaacc gtcgccgcgt ctcggcccgc accgaggccg agctcgaagc gacctactgg       600
     gaatccctcg accagatgct cgcgcgggtc gacatcgtgt cggtgaactg cccgcatacg       660
     cccgcgacct accatctgct ctcggcgcgc cgcctcaagc tcctcaagcc cgaggcggtg       720
     gtggtgaaca ccgcccgcgg cgaggtgatc gacgagaccg cgctcgcgcg cctcatcgag       780
     gtcggggaca tcgcgggggc gggtctcgac gtgttcgagc aggagccggc ggtgagcccg       840
     cgcctggtga agctcgccaa ggccggcaag gtggtgctgc tgccgcatat gggctcggcc       900
     acgcacgaga gccgcatcga catgggcgag aaggtcatca tcaacatcaa gaccttcatg       960
     gacgggcacc ggccgccgga ccgggtgctg ccgagcatgc tctga                      1005
//

If you have problems or comments...

PBIL Back to PBIL home page