(data stored in ACNUC7421 zone)

EMBL: CP001349.PE369

CP001349.PE369       Location/Qualifiers
FT   CDS_pept        423623..424186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0379"
FT                   /product="protein of unknown function DUF1058"
FT                   /note="PFAM: protein of unknown function DUF1058; KEGG:
FT                   met:M446_2231 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55421"
FT                   /db_xref="InterPro:IPR010466"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB28"
FT                   /inference="protein motif:PFAM:PF06347"
FT                   /protein_id="ACL55421.1"
FT                   /translation="MPLARAGALLIALMAAWAALASLPASAAPKLPETGLGPVSGLPMP
FT                   RYVSLKTDRVNLREGPSKDHRTLWVFQRAGLPVEIVSEFETWRRIRDSEGTEGWVLHSL
FT                   LSGRRTAVVLAQGDKAAPVPLYAEPEGRGGVVAQLQAGVIGSIKSCSGTWCRLIVALPQ
FT                   KRGDVDGYLRQDRLWGVYPNEKVE"
     atgccccttg cgcgcgccgg tgccctcctg atcgcgctca tggctgcctg ggcggctctg        60
     gccagcctgc ccgcatccgc cgccccgaag ctgccggaga ccggtctcgg gccggtgagc       120
     gggctgccga tgccccgcta cgtcagcctc aagaccgacc gcgtgaacct gcgcgagggc       180
     ccctccaagg atcaccggac cctctgggtg ttccagcggg cggggctgcc ggtcgagatc       240
     gtgtcggaat tcgagacctg gcggcgcatc cgcgactcgg agggcaccga gggctgggtg       300
     ctgcactccc tgctctccgg ccggcgcacg gccgtggtgc tggcgcaggg ggacaaggcg       360
     gcgccggtcc cgctctacgc ggagccggag ggccgcggcg gcgtcgtggc ccagctccag       420
     gcgggggtga tcggcagcat caagtcctgc agcggaacgt ggtgccgcct catcgtcgcc       480
     ctgccgcaga agcggggcga cgtggacggc tacctgcgcc aggatcgcct gtggggcgtc       540
     tacccgaacg agaaggtgga gtag                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page