(data stored in ACNUC7421 zone)

EMBL: CP001349.PE37

CP001349.PE37        Location/Qualifiers
FT   CDS_pept        complement(38939..41011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0038"
FT                   /product="methylmalonyl-CoA mutase, large subunit"
FT                   /EC_number="5.4.99.2"
FT                   /note="TIGRFAM: methylmalonyl-CoA mutase, large subunit;
FT                   PFAM: methylmalonyl-CoA mutase; cobalamin B12-binding
FT                   domain protein; KEGG: met:M446_0036 methylmalonyl-CoA
FT                   mutase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55089"
FT                   /db_xref="GOA:B8IT27"
FT                   /db_xref="InterPro:IPR006098"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006159"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT27"
FT                   /inference="protein motif:TFAM:TIGR00641"
FT                   /protein_id="ACL55089.1"
FT                   /translation="MPPPRGLRNTRDEGAMGDQAMGTAQRDKPWIIRTYAGHSTAAESN
FT                   ALYRRNLAKGQTGLSVAFDLPTQTGYDPDHELARGEVGKVGVSIAHLGDMRTLFKDIPL
FT                   AQMNTSMTINATAPWLLSLYLAVAEEQGAPISVLQGTTQNDIIKEYLSRGTYVFPPAPS
FT                   LRLTKDVILFTTKQVPKWNPMNVCSYHLQEAGATPVQELSYALAIAIAVLDTVRADPDF
FT                   DEASFSEVVGRISFFVNAGLRFITEICKMRAFCDLWDEITRDRYGITDPKKRIFRYGVQ
FT                   VNSLGLTEQQPENNVHRILIEMLAVTLSKRARARAVQLPAWNEALGLPRPWDQQWSMRM
FT                   QQILAYETDLLEFDDIFDGSKVIDAKVEALKAETRSELERIGALGGAVAAVETGALKRA
FT                   LVESNARRIAAIERGEQVVVGVNRFETGEPSPLTAGDGAIFTVSETVEMEAQQRIRAWR
FT                   AERDAKAVARALDDLEAAARSGANIMPVSIACAKAGVTTGEWGERLREVFGEYRAPTGV
FT                   TPETTTSGAAEEARLLIADLGERLGETPKLVVGKPGLDGHSNGAEQIALRARDVGFDVT
FT                   YDGIRQTPDEIVAKARERGAHVIGLSILSGSHVPLVREVKARLRREGLDHVPVVVGGII
FT                   SPEDELVLKNMGVAAVYTPKDYAMDTIMVGLAKVVEKALARREADSALPNREQVF"
     atgccgcccc cgcgagggct gaggaacacg agggacgagg gcgccatggg cgatcaggcg        60
     atgggaacgg cgcagcgcga caagccgtgg atcatccgca cctatgcggg gcattccacc       120
     gctgcggaat cgaacgccct ctaccggcgc aacctcgcca aggggcagac cggcctgtcg       180
     gtggccttcg acctgccgac ccagaccggc tacgacccgg accacgagct cgcccgcggc       240
     gaggtcggca aggtgggcgt ctcgatcgcg catctcggcg acatgcggac cctgttcaag       300
     gacatcccgc tcgcgcagat gaacacctcg atgacgatca acgcgacggc gccctggctc       360
     ctgtcgctct acctcgccgt cgccgaggag cagggcgccc cgatctcggt cctgcagggc       420
     acgacgcaga acgacatcat caaggagtac ctgtcgcgcg gcacctacgt gttcccgccc       480
     gcgccgagcc ttcggctcac caaggacgtg atcctgttca cgaccaagca ggtgccgaag       540
     tggaacccga tgaacgtctg ctcctaccac ctgcaggagg cgggggcgac gccggtccag       600
     gaactgtcct acgcgctcgc catcgccatc gcggtgctcg acaccgtgcg ggccgacccc       660
     gatttcgacg aggccagctt ctcggaggtg gtcgggcgca tctccttctt cgtcaatgcg       720
     ggcctcaggt tcatcaccga gatctgcaag atgcgggcct tctgcgatct ctgggacgag       780
     atcacccgcg accgctacgg tatcacggac ccgaagaagc gcatcttccg ctacggcgtg       840
     caggtgaact ccctcggcct caccgagcag cagcctgaga acaacgtcca ccgcatcctc       900
     atcgagatgc tggcggtgac gctctcgaag cgcgcccgcg cccgcgccgt gcagcttccg       960
     gcctggaacg aggcgctcgg cctgccgcgc ccctgggacc agcaatggtc gatgcgcatg      1020
     cagcagatcc tcgcctacga gaccgacctc ctggaattcg acgacatctt cgacggctcg      1080
     aaggtgatcg acgccaaggt cgaggcgctc aaggccgaga cgcgctcgga gctggagcgg      1140
     atcggcgcgc tcggcggcgc ggtggcggcg gtcgagaccg gcgccctcaa gcgcgccctc      1200
     gtcgagtcga atgcccgccg cattgcggcg atcgagcgcg gcgagcaggt cgtcgtcggc      1260
     gtcaaccgct tcgagaccgg cgagccctca ccgctgaccg cgggggacgg ggcgatcttc      1320
     accgtctccg aaaccgtcga gatggaggcc cagcagcgca tccgcgcctg gcgcgccgag      1380
     cgcgatgcca aggccgtggc cagggccctc gacgacctcg aggcggcagc ccgctcgggc      1440
     gccaatatca tgccggtctc gatcgcctgc gcgaaggcgg gcgtgacgac gggcgaatgg      1500
     ggagagcgcc tgcgcgaggt gttcggcgag taccgggccc ccaccggcgt gactcccgag      1560
     accaccacct cgggggcggc cgaggaggcc cgcctcctca tcgccgatct cggcgagcgc      1620
     ctcggcgaga cgccgaagct cgtggtcggc aagcccggcc tcgacggtca ttcgaacggc      1680
     gccgagcaga ttgcgctccg cgcccgggac gtcggcttcg acgtgaccta tgacggcatc      1740
     cggcagaccc cggacgagat cgtcgccaag gcgcgcgagc gcggcgccca tgtgatcggc      1800
     ctgtcgattc tgtccggctc ccacgtgccg ctggtgcgcg aggtgaaggc gcggctgcgc      1860
     cgcgaggggc tcgaccacgt gccggtcgtg gtcggcggca ttatctcgcc ggaggacgag      1920
     ctcgtcctca agaacatggg cgtggcggcg gtctacacgc cgaaggacta tgccatggac      1980
     acgatcatgg tgggcctcgc caaggtggtg gagaaggcgc tcgcccggcg cgaggccgat      2040
     tcggcgctgc cgaaccgcga acaggtgttt tga                                   2073
//

If you have problems or comments...

PBIL Back to PBIL home page