(data stored in ACNUC7421 zone)

EMBL: CP001349.PE370

CP001349.PE370       Location/Qualifiers
FT   CDS_pept        424204..424629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0380"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sme:SMc01008 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55422"
FT                   /db_xref="InterPro:IPR018727"
FT                   /db_xref="InterPro:IPR038282"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB29"
FT                   /inference="similar to AA sequence:KEGG:SMc01008"
FT                   /protein_id="ACL55422.1"
FT                   /translation="MTVPQEYVQASRDFERFLLAARDALGHATTHRTYATIYSVLLVFR
FT                   RHVSVRDGLRFATVLPPVLRAIFVSDWDPAEPVRDFADRETLTAEMLSVRGNHNVSPAD
FT                   AIAVVARVLRDHVDQEAYDRVLATLPEPARDYWRDAM"
     atgacggtcc cgcaggaata cgtgcaggcg tcccgcgact tcgagcgctt cctgctggcc        60
     gcccgcgatg cgctcggcca cgcgacgacc catcggacct acgcgacaat ctacagcgtg       120
     ctcctcgtct tccgccggca cgtgagcgtg cgcgacgggc tccggttcgc caccgtgctg       180
     ccgcccgtgc tgcgggccat cttcgtttcc gactgggatc cggcggagcc ggtccgggac       240
     ttcgcggatc gcgagaccct cacggccgag atgctgagcg tgcggggaaa ccataacgtc       300
     tccccggccg atgccatcgc ggtcgtggcg cgggtgctcc gcgaccatgt cgaccaggaa       360
     gcctacgacc gggtgctcgc caccctgccc gagccggccc gggactactg gcgcgacgcc       420
     atgtga                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page