(data stored in ACNUC7421 zone)

EMBL: CP001349.PE371

CP001349.PE371       Location/Qualifiers
FT   CDS_pept        complement(424721..425215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0381"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: met:M446_2230
FT                   ferric uptake regulator family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55423"
FT                   /db_xref="GOA:B8IB30"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB30"
FT                   /inference="protein motif:PFAM:PF01475"
FT                   /protein_id="ACL55423.1"
FT                   /translation="MNDLSPLHAVLSARTPAIHADGAAGQRRGCPLSELRDRLRRAGLR
FT                   PTRQRLSLGWLLFGKGDRHLTAEMLYDEAMRAKVPVSLATVYNTLHQFTEAGLLRQLAL
FT                   DGSKAYFDTNPSEHHHFFLEEEGQVLDMPDCGITVDALPQPPEGMEIAGVEVIVRLRRR
FT                   T"
     atgaacgacc tgtcgcctct gcatgccgtg ctcagcgcac gcaccccggc catccacgcc        60
     gatggtgcgg cggggcagcg ccgcggctgc ccgctgtcgg agctgcgtga ccggctgcgc       120
     cgcgccgggc tgcgcccgac ccgccagcgc ctctccctcg gctggctgct gttcggcaag       180
     ggagaccggc acctgaccgc cgaaatgctc tacgacgagg cgatgcgggc caaggtcccg       240
     gtgtcgctgg cgaccgtcta caacacgctc caccagttca ccgaggccgg gctcctgcgc       300
     cagctcgccc tcgacggctc caaggcctat ttcgacacca acccgagcga gcaccaccat       360
     ttcttcctgg aggaggaggg gcaggtgctc gacatgcccg attgcggcat cacggtcgac       420
     gcgctgccgc agccgcccga gggcatggag atcgcgggcg tcgaggtgat cgtgcggctc       480
     cgccggcgga cctga                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page