(data stored in ACNUC7421 zone)

EMBL: CP001349.PE372

CP001349.PE372       Location/Qualifiers
FT   CDS_pept        425454..426005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0382"
FT                   /product="beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabA"
FT                   /EC_number="4.2.1.59"
FT                   /note="TIGRFAM: beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabA; PFAM:
FT                   Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase
FT                   FabA/FabZ; KEGG: met:M446_2229
FT                   beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabA"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55424"
FT                   /db_xref="GOA:B8IB31"
FT                   /db_xref="InterPro:IPR010083"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB31"
FT                   /inference="protein motif:TFAM:TIGR01749"
FT                   /protein_id="ACL55424.1"
FT                   /translation="MSADTPATDAQTRPSQFSYEDLLACGRGEMFGPGNAQLPLPPMLM
FT                   FDRIVSIGRDGGAHGKGHVRAELDVRPDLWFFPCHFQGDPVMPGCLGLDALWQMVGFFL
FT                   GWLGSPGRGRALGVGEVKFTDQVLPSVRKVVYGVDLKRVRQGRLVLGIADGWLEADGRR
FT                   IYEAQDLRVGLFQAAAPAGG"
     atgtccgccg acacgcccgc caccgacgcc cagacccggc cctcgcagtt ctcctacgag        60
     gatctgctcg cctgcgggcg cggcgagatg ttcggccccg gaaacgcgca gcttccgctc       120
     ccgcccatgc tgatgttcga ccgcatcgtc tcgatcggcc gggacggcgg cgcccacggc       180
     aaggggcatg tgcgggcgga actcgacgtg cggccggacc tctggttctt tccctgccat       240
     ttccagggcg atccggtgat gccgggctgc ctcgggctcg acgcgctctg gcagatggtc       300
     gggttcttcc tcggctggct cggctctccg ggccgcggcc gggcgctcgg cgtcggcgag       360
     gtgaagttca ccgaccaggt gctgccgagc gtccgcaagg tggtctacgg cgtcgacctc       420
     aagcgcgtac gccagggccg gctcgtgctc gggatcgcgg atggctggct tgaggcggat       480
     ggccgccgca tctacgaagc ccaggacctg cgggtgggcc tgttccaggc tgccgccccc       540
     gcgggcggtt ga                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page