(data stored in ACNUC7421 zone)

EMBL: CP001349.PE373

CP001349.PE373       Location/Qualifiers
FT   CDS_pept        426078..427304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0383"
FT                   /product="Beta-ketoacyl synthase"
FT                   /note="PFAM: Beta-ketoacyl synthase; KEGG: met:M446_2228
FT                   beta-ketoacyl synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55425"
FT                   /db_xref="GOA:B8IB32"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB32"
FT                   /inference="protein motif:PFAM:PF00109"
FT                   /protein_id="ACL55425.1"
FT                   /translation="MRRVAITGMGIVSSIGNNTQEVLASLREARSGITHAESFAAHGFR
FT                   CQVQGAPTLDPESVVDRRAMRFHGGGTAWNHVAMEQAIRDAGLEEREVSHERTGIIMGS
FT                   GGPSTRAIVEAADIARAKGPKRVGPFAVPKAMCSTASATLATWFKIKGVNYSISSACAT
FT                   SNHCIGNAAEIIQAGRQDIIFAGGCEELDWTLSVLFDAMGAMSAKYNDTPARASRAYDA
FT                   GRDGFVIAGGAGVLVLEELEHAKARGARIYGEIAGYGATSDGHDMVAPSGEGAVRCMRQ
FT                   ALAGLKGVTIDYINPHATSTPVGDDKEIEAIREVFGTGDSCPPISATKSLTGHSLGATG
FT                   VQEAIYSLLMMNNGFICESAHIDELDPAFADMPILRRRVDDARLGHVLSNSFGFGGTNA
FT                   TLILKHVDA"
     atgaggcgcg tcgcgatcac cgggatgggc atcgtctcgt ccatcggcaa caacacgcag        60
     gaagtgctgg cgagcctgcg cgaggcacga tccggcatca cccatgccga gtccttcgcg       120
     gcccacggct tccgctgtca ggtgcagggg gcgccgaccc tcgacccgga gagcgtggtc       180
     gaccggcgcg ccatgcgctt ccacggcggc ggcaccgcct ggaatcacgt ggcgatggag       240
     caggcgatcc gcgatgccgg cctcgaggag cgcgaggtct cgcacgagcg caccggcatc       300
     atcatgggct cgggcgggcc ctcgacccgc gccatcgtcg aagccgcgga catcgcccgc       360
     gccaagggcc cgaagcgcgt cggccccttc gcggtgccga aggcgatgtg ctcgacggcc       420
     tcggccacgc tcgccacgtg gttcaagatc aagggcgtga actactcgat ctcctccgcc       480
     tgcgcgacct cgaaccattg catcggcaac gccgccgaga tcatccaggc gggccggcag       540
     gacatcatct tcgcgggcgg ctgcgaggaa ctcgactgga ccctctcggt cctgttcgac       600
     gcgatgggcg ccatgtcggc caagtacaac gacaccccgg cccgggcctc gcgggcctac       660
     gacgcgggcc gcgacggctt cgtgatcgcg ggcggcgcgg gcgtgctggt gctcgaggag       720
     ttggagcacg ccaaggcgcg cggcgcgcgg atctacggcg agatcgccgg ctacggggcg       780
     acctcggacg ggcacgacat ggtggcgccc tcgggcgagg gcgcggtgcg ctgcatgcgc       840
     caggcgctcg ccggcctcaa gggcgtgacg atcgactaca tcaacccgca cgccacctcg       900
     acgccggtcg gcgacgacaa ggagatcgag gcgatccgcg aggtgttcgg caccggcgat       960
     tcctgcccgc cgatctccgc caccaagtcc ctcaccggcc actcgctcgg ggccaccggc      1020
     gtgcaggagg cgatctactc gctcctgatg atgaacaacg gcttcatctg cgagagcgcc      1080
     catatcgacg agctcgaccc ggccttcgcg gacatgccga tcctgcgccg ccgcgtggac      1140
     gacgcccggc tcggccatgt gctgtcgaat tccttcggct tcggcggcac caatgcgaca      1200
     ttgatcctga agcacgtcga cgcctga                                          1227
//

If you have problems or comments...

PBIL Back to PBIL home page