(data stored in ACNUC7421 zone)

EMBL: CP001349.PE374

CP001349.PE374       Location/Qualifiers
FT   CDS_pept        427344..428171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0384"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="KEGG: met:M446_2227 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55426"
FT                   /db_xref="GOA:B8IB33"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB33"
FT                   /inference="similar to AA sequence:KEGG:M446_2227"
FT                   /protein_id="ACL55426.1"
FT                   /translation="MTGLMAGKRGLIMGVANDHSIAWGVAKALAAQGAELAFTYQGEAL
FT                   GRRVTPLAASLGSRIVLPCDVEDLGSVDAVFTALGDAWPDGFDFVVHAIGYSDKTQLKG
FT                   RYVDATTRENFSRTMVISCFSFTEVAQRAAKRLRPGGALLTLTFGGATRVMPNYNVMGL
FT                   AKAALEASVRYLASDLGPDGIRVNAISAGPVRTLAGAGITDARLMFNHQRAHAPLRRNA
FT                   TIEEIGGAALYLLSDLSSGVTGEVHFVDCGFNIIAMPRPAVLKAQDDAGVVGD"
     gtgacgggtc tgatggcagg caagcgcggc ctcatcatgg gggtcgcgaa cgaccattcc        60
     atcgcctggg gcgtcgccaa ggccctcgcg gcccaggggg ccgagctggc cttcacctat       120
     cagggcgagg cactggggcg ccgggtgacg ccgctcgccg cctcgctcgg ctcgcggatc       180
     gtgctgccct gcgacgtgga ggatctggga agcgtcgatg cggtcttcac ggcgctgggc       240
     gacgcttggc cggacggctt cgacttcgtg gtccacgcca tcggctattc cgacaagaca       300
     cagctcaagg gacgctacgt cgacgcgacc acgcgcgaga acttttcccg cacgatggtg       360
     atctcctgct tctccttcac ggaggtggcg cagcgggcgg ccaagcgcct gcggccgggc       420
     ggcgcgctgc tcacgctgac cttcgggggc gccacccggg ttatgccgaa ctacaacgtg       480
     atgggcctcg ccaaggctgc cctggaggcc tcggtgcgct atctcgcctc cgatctcggc       540
     ccggacggca tccgggtgaa cgcgatctcg gccgggcccg tgcgcaccct cgcgggggcg       600
     ggcatcacgg atgcgcgcct gatgttcaac caccagcgcg cccatgcccc gctgcgccgc       660
     aacgccacca tcgaggagat cggcggggcg gcgctctacc tcctgtccga cctgtcgagc       720
     ggcgtcaccg gcgaggtcca cttcgtggat tgcggcttca acatcatcgc gatgccgcgc       780
     cccgccgtgc tgaaggccca ggacgatgcc ggggtggtgg gcgactga                    828
//

If you have problems or comments...

PBIL Back to PBIL home page