(data stored in ACNUC7421 zone)

EMBL: CP001349.PE375

CP001349.PE375       Location/Qualifiers
FT   CDS_pept        428546..430243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0385"
FT                   /product="adenine deaminase"
FT                   /EC_number="3.5.4.2"
FT                   /note="TIGRFAM: adenine deaminase; PFAM: amidohydrolase;
FT                   KEGG: met:M446_2226 adenine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55427"
FT                   /db_xref="GOA:B8IB34"
FT                   /db_xref="InterPro:IPR006679"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR026912"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8IB34"
FT                   /inference="protein motif:TFAM:TIGR01178"
FT                   /protein_id="ACL55427.1"
FT                   /translation="MPAEIARRIAQGAGREPADLVIRGARLLDLVTGELVPTDIAVCGE
FT                   VVVGTYGEYEGARVIEAASRIAVPGFIDTHLHIESSLITPHEFDRCVLPHGVTTAIWDP
FT                   HELANVLGTAAFDYALQASTETAMDIRVQLSSCVPATDLESAGARIEAADLLPYRDHPR
FT                   SLGIAEFMNFPGVVQADPGCLAKLAAFAGRHVDGHAPLLSGSGLNAYAAAGIRTDHEAT
FT                   GAAEALEKIRKGMTVLIREGSVSKDLAALAPLLTVATSPFLAFCTDDRNPLDIAEEGHL
FT                   DHLIRTAIRLGVPPLAAYRAASLSAATAFGLTDRGMIAPGRRADIVLLDDLEACAVARV
FT                   IAGGRAVEEALFAGRARTPAPGRGSVKAAPVAAEDFRIPGADGAETSVIGVVPGRIITE
FT                   HRRLELPAANGCAGCDLDQDVVKVAVIARHGRPGMGRGFVQGFGLRRGAIASSVGHDSH
FT                   NLCVVGADDADMAVAINRLIALQGGFVVAAGGTVLAELALPIAGLMSDLPFEAVRDALH
FT                   PLREAARTLGCTLPEPFLQVAFLPLPVIPHLKITDRGLVDVDRMRLLG"
     atgcccgctg agatcgcccg ccggatcgca cagggcgccg gccgcgaacc ggccgacctc        60
     gtgatccgcg gagcgcgcct cctcgatctc gtcaccggcg aactcgtgcc gaccgacatc       120
     gccgtctgcg gcgaggtcgt cgtcggcacc tacggggagt acgagggcgc gcgggtgatc       180
     gaggcggcga gccggatcgc ggtgccgggc ttcatcgaca cccatctcca catcgaatca       240
     tcgctcatca cgccgcacga attcgaccgg tgcgtgctgc cgcacggggt cacgacggcg       300
     atctgggatc cgcacgagct cgccaacgtg ctcggcacgg cggctttcga ctacgccctc       360
     caggcttcga ccgagacggc catggacatc cgggtgcagc tctcctcctg cgtgcccgcc       420
     acggatctcg agagcgccgg cgcccggatc gaggccgcgg acctcctccc ctaccgggac       480
     catccgcgct cgctggggat cgccgaattc atgaatttcc cgggcgtggt ccaagccgat       540
     cccggctgcc tcgccaagct cgcggccttc gccggccgcc atgtcgacgg ccacgcgccg       600
     ctgctctccg gatccggcct caacgcctat gcggcggcgg gcatccgcac cgaccacgag       660
     gccaccggcg ccgcggaggc gctggagaag atccgcaagg gcatgacggt actgatccgg       720
     gaagggtcgg tctcgaaaga cctggcggcg ctggcgcccc tcctcacggt cgcgacctcg       780
     cccttcctcg ccttctgcac cgatgaccgc aacccgctcg acatcgccga ggagggccat       840
     ctcgaccacc tcatccgcac ggcgatcagg ctcggcgttc cgccgctcgc ggcctaccgg       900
     gcggcctcgc tcagcgccgc gacggccttc ggcctcaccg accggggcat gatcgctccc       960
     gggcggcggg cggatatcgt gctcctcgac gatctcgaag cctgcgcggt cgcccgcgtg      1020
     atcgcgggcg ggcgagcggt cgaggaggcg ctcttcgccg gccgcgcccg cacccccgcg      1080
     cctggccgcg gcagcgtcaa ggccgctccg gtcgccgcgg aggacttccg catccccggc      1140
     gccgatgggg ccgagacctc ggtgatcggc gtcgtgccgg ggcgcatcat caccgagcac      1200
     cgccgtctgg agctcccggc cgcgaacgga tgcgcgggct gcgacctcga ccaggacgtg      1260
     gtgaaggtcg cggtgatcgc ccggcacggc aggccgggaa tggggcgcgg cttcgtgcag      1320
     ggcttcgggc tgcggcgcgg cgccatcgcc tcgtcggtcg gccatgacag ccacaatctc      1380
     tgcgtggtcg gggcggacga tgccgacatg gcagtggcga tcaaccggct gatcgccctc      1440
     cagggcggct tcgtggtggc ggcgggcggc accgtgctcg ccgagctggc gctgcccatc      1500
     gccgggctga tgagcgacct gcccttcgag gcggtgcgcg acgccctcca tcccctgcgg      1560
     gaggccgccc gcaccctcgg ctgcacgctg ccggagccct tcctccaggt ggcgttcctt      1620
     ccgctcccgg tgatcccgca cctgaagatc accgatcgcg gcctcgtcga cgtcgaccgc      1680
     atgaggctgc tgggctga                                                    1698
//

If you have problems or comments...

PBIL Back to PBIL home page