(data stored in ACNUC7421 zone)

EMBL: CP001349.PE376

CP001349.PE376       Location/Qualifiers
FT   CDS_pept        430347..431252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0386"
FT                   /product="HAD-superfamily hydrolase, subfamily IIA"
FT                   /note="TIGRFAM: HAD-superfamily subfamily IIA hydrolase
FT                   like protein; HAD-superfamily hydrolase, subfamily IIA;
FT                   PFAM: Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   met:M446_2225 HAD family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55428"
FT                   /db_xref="GOA:B8IB35"
FT                   /db_xref="InterPro:IPR006356"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB35"
FT                   /inference="protein motif:TFAM:TIGR01460"
FT                   /protein_id="ACL55428.1"
FT                   /translation="MADTRVKPRPDEVPILDGIADLAPRFDVILCDVWGVLHDGVRAHA
FT                   AAGDALTRFRALPGERPRRVVLVSNAPRPGSAIQVQLDGFGLPRSAYDAIVTSGDLTRA
FT                   LIAARGDAPLYHLGPDRDLPIFEGLPARRVPPDEAEHVVCTGLFDDDVETAEDYRPSLA
FT                   PLKERGLPMICANPDLVVERGARLIPCAGAIASLYEAMGGEVIYAGKPHRPVYEAAVEA
FT                   AAALDGLPPAPSGRVLAIGDAIRTDIAGAHGFGIASVLVARGIHAEELGCAAGAPLAEV
FT                   AHWLEAQPVHPDAVIEVLRW"
     atggcggata cgcgcgtgaa gcccaggccg gacgaggtcc cgatcctcga tggcatcgcc        60
     gatctcgcgc cgcgcttcga cgtgattctc tgcgacgtct ggggcgtgct gcatgacggc       120
     gtgcgcgccc acgcggccgc gggcgacgcg ctgacgcggt tccgtgctct gcccggcgag       180
     cgcccgcggc gggtggtact ggtctcgaac gcaccgcggc cgggctcggc catccaggtg       240
     cagctcgacg ggttcggcct gccgcgctcg gcctacgatg ccatcgtgac ctccggcgac       300
     ctcacccgcg ccctgatcgc cgccaggggc gacgcgccgc tctaccatct cggccccgac       360
     cgggacctgc cgatcttcga ggggctgccg gcgcggcgcg tgccgcccga tgaggccgag       420
     cacgtggtct gcaccgggct gttcgacgac gacgtcgaga cggcggagga ttaccgcccc       480
     tccctggctc ccctgaagga gcgcgggctg ccgatgatct gcgccaatcc cgacctcgtg       540
     gtcgagcgcg gggcgcggct cattccctgc gcgggggcga tcgcgagcct ctacgaggcg       600
     atgggcggcg aggtgatcta tgccggcaag ccgcacaggc cggtctatga ggcggccgtc       660
     gaggccgcgg ccgccctcga cgggctgccg ccggcaccgt ccgggcgggt gctcgccatc       720
     ggcgacgcga tccgcaccga tatcgccgga gcccatggct tcggtatcgc ctccgtgctg       780
     gtggcgcggg gcatccacgc cgaagagctc ggctgcgcgg ccggcgcccc gctcgccgag       840
     gtggcgcatt ggctggaagc ccagccggtg cacccggatg cggtcatcga ggtgctgcgc       900
     tggtga                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page