(data stored in ACNUC7421 zone)

EMBL: CP001349.PE377

CP001349.PE377       Location/Qualifiers
FT   CDS_pept        complement(431253..431843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0387"
FT                   /product="putative chemotaxis phosphatase, CheZ"
FT                   /note="KEGG: met:M446_2224 putative chemotaxis phosphatase,
FT                   CheZ"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55429"
FT                   /db_xref="GOA:B8IB36"
FT                   /db_xref="InterPro:IPR007439"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB36"
FT                   /inference="similar to AA sequence:KEGG:M446_2224"
FT                   /protein_id="ACL55429.1"
FT                   /translation="MLGDRMVRLVTMLMRKRTDGPSASAAPTADTIDAGTIVQDLIEIA
FT                   DYIKRLKQAIAHLRANELRCDRLPMAHDELGSVVSATASATNRIMEVAEGILSIEDDTL
FT                   EGYRAKVEAGIFQIFEACTFQDITGQRIAKVVDALGQVEERLTHFASVVKVSDGEVDPE
FT                   EARRKARREELLLNGPQLKGPETPQDAIDALFA"
     ttgctcgggg acagaatggt ccggctggtc accatgctga tgcgaaagag gaccgacggg        60
     ccatccgcgt cggcggcgcc cacggccgac accatcgatg ccggcacgat cgtgcaggat       120
     ctcatcgaga tcgcggatta catcaagcgg ctcaagcagg cgatcgccca cctgcgggcg       180
     aacgagctgc gttgcgaccg cctgcccatg gcgcatgacg aactcggcag cgtcgtttcc       240
     gccaccgcga gcgcgaccaa ccgcatcatg gaggttgcgg aaggcatcct gtcgatcgag       300
     gacgacacgc tcgagggcta ccgcgccaag gtcgaggcgg ggatcttcca gatcttcgag       360
     gcctgcacct tccaggacat caccgggcag cgcatcgcca aggtcgtcga cgcgctgggt       420
     caggtcgagg agcgcctgac ccacttcgcg tctgtcgtga aggtcagcga cggcgaggtc       480
     gacccggagg aggcccgtcg caaggcgcgg cgcgaggaac tcctcctgaa tggcccgcag       540
     ctcaaggggc ccgagacgcc gcaggacgcg atcgacgcac tcttcgcctg a                591
//

If you have problems or comments...

PBIL Back to PBIL home page