(data stored in ACNUC7421 zone)

EMBL: CP001349.PE378

CP001349.PE378       Location/Qualifiers
FT   CDS_pept        complement(431985..432368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0388"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   met:M446_2223 response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55430"
FT                   /db_xref="GOA:B8IB37"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB37"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACL55430.1"
FT                   /translation="MALDLSMPILVVDDYQTMVRIIRNLLKQLGFEEVDDASDGTGALA
FT                   KLKQKKYGLVISDWNMEPMTGYELLRHVRADDALRTTPFIMVTAESKTENVIAAKKAGV
FT                   NNYIVKPFNAQTLKTKIEAVCGA"
     atggccctcg acctcagcat gccgatcctc gtggtagacg actaccagac gatggtccgc        60
     atcatccgca acctgctcaa gcagctcggt ttcgaggaag tcgacgatgc gtccgacggc       120
     accggcgcgc tcgcgaagct gaagcagaag aaatacggcc tcgtgatctc cgactggaac       180
     atggagccga tgacgggcta cgagctgctg cggcacgtgc gggccgacga cgcgctgcgc       240
     acgacgccct tcatcatggt gacggcggaa tcgaagaccg agaacgtcat cgcggccaag       300
     aaggccgggg tgaacaacta catcgtcaag ccgttcaacg cgcagacgct gaagaccaag       360
     atcgaggcgg tttgcggcgc ctga                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page