(data stored in ACNUC7421 zone)

EMBL: CP001349.PE379

CP001349.PE379       Location/Qualifiers
FT   CDS_pept        432812..433828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0389"
FT                   /product="riboflavin biosynthesis protein RibF"
FT                   /note="TIGRFAM: riboflavin biosynthesis protein RibF; PFAM:
FT                   FAD synthetase; Riboflavin kinase; KEGG: met:M446_2222
FT                   riboflavin biosynthesis protein RibF"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55431"
FT                   /db_xref="GOA:B8IB38"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB38"
FT                   /inference="protein motif:TFAM:TIGR00083"
FT                   /protein_id="ACL55431.1"
FT                   /translation="MPPSDETAATGSAASAPPRSVLIVNRDGEPVPEGLRGAVAAIGNF
FT                   DGLHRGHRALIAAVREIAAAAGRPSAVLTFEPHPREFFAPDVGMFRLTDEGAKLAVLAR
FT                   LGIDGVFVRRFDAALAGTSAAAFVGRLLKDELGLTGVVIGHDFHFGRGREGTPAVLQAL
FT                   CAEHGLTCRVIEPVAAECGEVPVSSSAIRAALEAGDVAGANRLLGFRWFVQGVVRHGDK
FT                   RGRTLGFPTANVALPACGLAHGIYAVRVRLADGALREGVASYGRRPTFDNGAPLLETTL
FT                   FDFSGDLYGQRIAVEFVGFLRGEARFDSAEALVAQMHEDAAQARALLARDEVPSMLG"
     atgccgccga gcgacgagac cgccgcgaca ggttccgcgg cgtccgcccc gccgcgttcc        60
     gtgctgatcg tcaaccgaga cggcgaaccg gtgcccgagg gcctgcgcgg cgcggtcgcg       120
     gcgatcggca atttcgacgg cctgcatcgg gggcatcgcg ccctgattgc ggccgtgcgg       180
     gagatcgccg ctgccgccgg ccgcccgagc gccgtgctga ccttcgagcc gcatccgcgc       240
     gagttcttcg cgcccgacgt cggcatgttc cggctgaccg acgagggcgc gaaactcgcc       300
     gtgctggcgc ggctcggcat cgacggcgtc ttcgtgcgcc gcttcgacgc ggcgctcgcc       360
     ggcaccagcg cggccgcttt cgtggggcgg ctcctcaagg acgagctcgg cctcaccgga       420
     gtggtgatcg ggcacgactt ccacttcggg cgggggcggg agggaacgcc cgcggtgctg       480
     caggccctct gcgcggagca tggcctcacc tgccgggtga tcgagccggt cgcggccgag       540
     tgcggcgagg tgccggtctc gtcgagcgcc atccgggcgg ccctggaggc gggcgacgtg       600
     gccggggcca accgtctgct cggcttccgc tggttcgtgc agggggtggt gcgccacggc       660
     gacaagcgcg ggcgcaccct cggcttcccg accgccaacg tggcgctgcc ggcctgcggc       720
     ctggcccacg gcatctatgc ggtgcgggtg cgcctcgcgg acggcgccct gcgcgagggt       780
     gtggcaagct acgggcggcg cccgaccttc gacaacggtg ctcccctcct cgagacgacc       840
     ctgttcgact tctcgggcga cctctacggg cagaggatcg ccgtggagtt cgtcggcttc       900
     ctccgcggcg aggcccgctt cgatagcgcc gaggcgctgg ttgcgcagat gcacgaggac       960
     gcggcgcagg cccgtgccct gctggcgcgc gacgaggttc cgtcgatgct cggctaa         1017
//

If you have problems or comments...

PBIL Back to PBIL home page