(data stored in ACNUC7421 zone)

EMBL: CP001349.PE38

CP001349.PE38        Location/Qualifiers
FT   CDS_pept        41301..42596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0039"
FT                   /product="crotonyl-CoA reductase"
FT                   /note="TIGRFAM: crotonyl-CoA reductase; PFAM: Alcohol
FT                   dehydrogenase zinc-binding domain protein; Alcohol
FT                   dehydrogenase GroES domain protein; KEGG: met:M446_0037
FT                   crotonyl-CoA reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55090"
FT                   /db_xref="GOA:B8IT28"
FT                   /db_xref="InterPro:IPR010085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT28"
FT                   /inference="protein motif:TFAM:TIGR01751"
FT                   /protein_id="ACL55090.1"
FT                   /translation="MGAGAAVQPIAGGAGQLKDLYEIGEIPPLGHVPAKMYAWAIRRER
FT                   HGPPEQSMQIEVVPTWSIGDDEVLVLVMAAGVNYNGVWAGLGEPISPFDVHKAPFHVAG
FT                   SDASGIVWAVGAKVKRWKVGDEVIVHCNQDDGDDEECNGGDPMFSPSQRIWGYETPDGS
FT                   FGQFCRVQSRQLMKRPKHLTWEESACYTLTLATAYRMLFGHAPHTVRPGQNVLVWGASG
FT                   GLGVFGVQLCAASGANAIAVISDESKRDYVMSLGAKGVINRKEFNCWGQLPKVNSPEYN
FT                   EWLKEARKFGKAIWDITGKGNDVDIVFEHPGEATFPVSTLVVKRGGMVVFCAGTTGFNI
FT                   TFDARYVWMRQKRIQGSHFAHLKQAAAANQFVLDQRVDPCMSELFPWDKIPVAHTKMWK
FT                   NQHAPGNMAVLVNSPKAGLRTFDDVLELSGSR"
     atgggtgcgg gcgctgcggt gcagccgatc gccgggggtg cgggtcagtt gaaggatctc        60
     tacgagatcg gcgagatccc gccgctcggc cacgtgccgg ccaagatgta tgcctgggcc       120
     atccgccggg agcgccacgg gccgccggag cagtcgatgc agatcgaggt cgtgccgacc       180
     tggtcgatcg gcgacgacga ggtgctggtc ctcgtgatgg cggccggcgt gaactacaac       240
     ggagtctggg cgggcctcgg cgagccgatc tcgcccttcg acgtgcacaa ggcgccgttc       300
     cacgtcgcgg gctcggacgc ctcggggatc gtctgggcgg tcggcgccaa ggtgaagcgc       360
     tggaaggtcg gcgacgaggt catcgtccac tgcaaccagg acgatgggga cgacgaggag       420
     tgcaatggcg gcgacccgat gttctcgccg tcgcagcgga tctggggcta cgagaccccg       480
     gacggctcct tcggccagtt ctgccgggtg cagtcgcgcc agctgatgaa gcggcccaag       540
     cacctgacct gggaggaatc cgcctgctac accctcaccc tggccaccgc ctaccggatg       600
     ctgttcggcc atgcgcccca cacggtgaga ccgggccaga acgtgctggt ctggggcgcc       660
     tccggcggcc tcggcgtgtt cggcgtgcag ctctgcgcgg cctccggcgc caacgccatc       720
     gcggtgatct ccgacgagtc gaagcgcgac tacgtcatga gcctcggcgc caagggcgtc       780
     atcaaccgca aggagttcaa ctgctggggc cagctcccga aggtcaactc gcccgaatac       840
     aatgagtggc tgaaggaggc ccgcaagttc ggcaaggcga tctgggacat caccggcaag       900
     ggcaacgacg tcgacatcgt cttcgagcat ccgggcgagg cgaccttccc ggtctcgacg       960
     ctggtggtga agcgcggcgg catggtggtg ttctgcgccg gcacgaccgg cttcaacatc      1020
     accttcgatg cccgctacgt ctggatgcgc cagaagcgga tccagggctc gcacttcgcc      1080
     catctcaagc aggcggccgc ggcgaaccag ttcgtgctcg accagcgggt cgatccctgc      1140
     atgagcgagc tcttcccctg ggacaagatc ccggtggccc ataccaagat gtggaagaac      1200
     cagcacgccc ccggcaacat ggcggtgctg gtgaactcgc cgaaggcggg tctgcgcacc      1260
     ttcgacgacg tgctggaact atccggctcg cgctga                                1296
//

If you have problems or comments...

PBIL Back to PBIL home page