(data stored in ACNUC7421 zone)

EMBL: CP001349.PE380

CP001349.PE380       Location/Qualifiers
FT   CDS_pept        complement(433981..434256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0390"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2221 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55432"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB39"
FT                   /inference="similar to AA sequence:KEGG:M446_2221"
FT                   /protein_id="ACL55432.1"
FT                   /translation="MRTLVPILVLAVSLSAPALAAEARGSAVQPRAAAPYSGSPQVGTP
FT                   YDDIDATGSVGPTDPILIPDYDGPEIDVDRPRRDETERALREFIPE"
     atgcgcaccc tcgtccccat cctcgtcctc gcggtgtcac tgagcgcccc ggcgctcgcc        60
     gccgaggcca ggggctcggc cgtgcagccg cgggccgcag cgccctatag cggatcgccc       120
     caggtcggaa cgccctacga cgacatcgac gccaccggca gcgtgggacc gaccgacccg       180
     atcctgatcc cggattacga cgggcccgag atcgatgtcg accggccgcg ccgcgacgag       240
     accgagcggg cgctgcgcga gttcattccg gaatag                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page