(data stored in ACNUC7421 zone)

EMBL: CP001349.PE381

CP001349.PE381       Location/Qualifiers
FT   CDS_pept        434589..437558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0391"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /note="TIGRFAM: isoleucyl-tRNA synthetase; KEGG:
FT                   met:M446_2220 isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55433"
FT                   /db_xref="GOA:B8IB40"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB40"
FT                   /inference="protein motif:TFAM:TIGR00392"
FT                   /protein_id="ACL55433.1"
FT                   /translation="MTETKPASGRDYSETLFLPRTDFPMRAGLPEREPEILKRWQAIDL
FT                   YGRIRAAAAGRPKFVLHDGPPYANGHIHIGTALNKILKDVVVRAAGLLGTDANYVPGWD
FT                   CHGLPIEWKIEEQYRAKGRNKDEVPVIEFRRECRAFAEHWLSVQREEFKRLGVTGDWDH
FT                   PYSTMAYPAEAQIARELMTFAMTGQLYRGSKPVMWSVVEKTALAEAEVEYEDIVSDAIW
FT                   AAFPVVTSADPALAGAHVVIWTTTPWTIPANRAVAYSRKISYGLYRVSAAPEENWVQPD
FT                   FRCIVADELAGDVFKAARVDAVERLADVAPEALAGLTLAHPLGGWNEGYRFPVPMLEGE
FT                   HVTDEAGTGFVHTAPSHGREDFEVWMANSRALRERGIDVRIPYTVDADGVLTVEAPGFT
FT                   GRRVLTEKGEKGDANKAVIAALAEAGTLVARGTLKHSYPHSWRSKKRVIFRNTPQWFIA
FT                   LDAPVASLGSKTLREVALREIAATEWVPPQGQNRITGMIANRPDWVVSRQRAWGVPITV
FT                   FVKKGTSEILRDERVNARIVAAFAEEGADAWFADPDGARFLAPDHDPAAYEKVTDVLDV
FT                   WFDSGSTHAFTLEDPVAFPGLAGIRRRRDGGDDTVMYLEGSDQHRGWFHSSLLESCGTR
FT                   GRAPYDVVLTHGFVLDPKGEKMSKSRGNVVAPQDVIAASGADILRLWVAASDYTDDLRI
FT                   GPPIIKTFSETYRKLRNSLRWMLGTLAHHRPEDRVAPQAMPELERFILHRLAELDGEIR
FT                   EAYRTYDFKRVVALLNGFMTGDLSSFYFDVRKDALYCDPLSSTVRRAALTVVDETFRRV
FT                   VVWLAPVLAFTAEEAWLSRYPSEDGSVHLQTLPDTPSDWRDEALAARWARIRRVRRVVT
FT                   GALEIERAKKRIGASLEAAPIVYLADPDLQAALDGIDFAEICITSDIRIEAGEGPQDAF
FT                   RLDDVGGVAVVPALAEGRKCARSWKVLPSVGSDPDYPDVTPRDAQALREWDALHAKAAE
FT                   "
     atgaccgaga ccaagcccgc ctccgggcgc gactattccg agacgctgtt cctgccccgc        60
     accgacttcc cgatgcgggc cggcctgccc gagcgcgagc cggagatcct gaagcgctgg       120
     caggcgatcg acctctacgg ccgcatccgc gccgccgcgg cggggcgccc gaaattcgtc       180
     ctgcacgacg ggccgcccta cgccaacggc cacatccata tcggcacggc gctgaacaag       240
     atcctgaagg acgtggtggt gcgggccgcc ggcctgctcg gcaccgacgc caactacgtc       300
     ccgggctggg actgccacgg cctgccgatc gagtggaaga tcgaggagca gtaccgggcc       360
     aaggggcgca acaaggacga ggtgccggtc atcgagttcc gccgcgagtg ccgcgccttc       420
     gcggagcatt ggctgtcggt gcagcgcgag gagttcaagc ggctcggcgt caccggcgac       480
     tgggaccatc cctactcgac catggcctat ccggccgagg cgcagatcgc ccgcgagctg       540
     atgaccttcg cgatgaccgg ccagctctat cgcggctcca agccggtgat gtggtcggtg       600
     gtcgagaaga ccgcgctcgc cgaggccgag gtcgagtacg aggacatcgt cagtgacgcg       660
     atctgggccg ccttcccggt cgtgacctcc gccgacccgg ccctcgccgg cgcccacgtc       720
     gtcatctgga ccaccacccc ttggaccatc ccggccaacc gggccgtggc ctattcccgc       780
     aagatttcgt acggacttta tcgtgtttcc gccgctcctg aagagaactg ggtccaacct       840
     gattttcgtt gcattgttgc tgacgaactc gcgggcgacg tcttcaaggc tgctcgggtc       900
     gatgctgtgg agcgcttggc cgacgtggcg cccgaggcgc tggcggggct gacgctcgcg       960
     catccgctcg gcgggtggaa cgagggctac cgcttcccgg tgccgatgct ggagggcgag      1020
     cacgtgaccg acgaggccgg cacgggcttc gtccacacgg cgccgagcca cggccgcgag      1080
     gacttcgagg tctggatggc gaacagccgc gccctgcgcg agcgcggcat cgatgtcagg      1140
     atcccctaca cggtcgacgc ggacggcgtg ctgaccgtcg aggcgccggg cttcaccggc      1200
     cggcgggtgc tgaccgagaa gggcgagaag ggcgatgcca acaaggcggt gatcgcggcc      1260
     ctcgccgagg ccggcacgct tgtcgcgcgc ggcacgctga agcacagcta cccgcattcc      1320
     tggcgctcga agaagcgcgt catcttccgc aacacgccgc aatggttcat cgccctcgac      1380
     gcccccgtgg cgtcgctcgg gtcgaagacc ctgcgcgagg tggctctgcg cgagatcgcc      1440
     gccaccgaat gggtgccgcc gcaggggcag aaccgcatca ccggcatgat cgccaaccgg      1500
     ccggactggg tggtgtcccg ccagcgcgcc tggggcgtgc cgatcacggt cttcgtgaag      1560
     aagggcacga gcgagatcct gcgcgacgag cgggtcaatg cccgcatcgt cgcggccttc      1620
     gcggaagagg gcgcggatgc atggttcgcc gatccggacg gcgcccgctt cctcgccccc      1680
     gaccacgacc cggccgccta cgagaaggtc acggacgtcc tcgacgtctg gttcgattcg      1740
     ggctcgaccc atgccttcac gctggaggat ccggtcgcct tcccggggct cgccggcatc      1800
     cgccgccgcc gcgacggcgg cgacgacacg gtgatgtacc tggagggctc ggaccagcac      1860
     cgcggctggt tccattcctc gctgctcgaa tcctgcggca cccgcggccg cgcgccctac      1920
     gacgtggtgc tcacccacgg cttcgtcctc gaccccaagg gcgagaagat gtcgaagtcg      1980
     cgcggcaacg tggtcgcccc gcaggacgtg atcgcggcct cgggcgccga catcctgcgc      2040
     ctgtgggtgg ccgcctccga ctacacggac gacctgcgca tcggcccgcc gatcatcaag      2100
     accttctcgg agacctaccg gaagctgcgc aattccttac gctggatgct cggcacgctc      2160
     gcccatcacc ggccggagga ccgcgtcgcg ccgcaggcca tgccggagct ggagcgcttc      2220
     atcctgcacc ggctcgccga gctcgacggg gagatccgcg aggcctaccg gacctacgat      2280
     ttcaagcggg tcgtggcgct cctcaacggc ttcatgaccg gcgatctctc ctcgttctac      2340
     ttcgacgtgc gcaaggacgc gctctactgc gatccgctct ccagcacagt gcgccgggcc      2400
     gcgctcacgg tggtggacga gaccttccgg cgcgtggtgg tctggctcgc ccccgtcctc      2460
     gccttcacgg ccgaggaggc gtggctgtcg cgctatccct ccgaggacgg ctcggtccat      2520
     ctgcagaccc tgccggacac gccgtcggac tggcgcgacg aggcgctggc ggcccgctgg      2580
     gcgaggatcc ggcgcgtgcg ccgggtggtg accggggcgc tggagatcga gcgcgcgaag      2640
     aagcgcatcg gtgcgagcct ggaggcggcc ccaatcgtct acttggcgga tcccgatctg      2700
     caggcggcgc tcgacggcat cgacttcgcg gagatctgca tcacctcgga tatccggatc      2760
     gaggcgggcg agggcccgca ggacgccttc cggctcgacg acgtcggcgg cgtcgccgtg      2820
     gtcccggccc tggccgaggg ccgcaaatgc gcccgctcgt ggaaggtgct gccgagcgtc      2880
     ggcagcgatc cggactatcc ggacgtgacg ccccgcgacg cgcaggccct gcgcgagtgg      2940
     gatgccctgc acgccaaggc cgcggaatga                                       2970
//

If you have problems or comments...

PBIL Back to PBIL home page