(data stored in ACNUC7421 zone)

EMBL: CP001349.PE382

CP001349.PE382       Location/Qualifiers
FT   CDS_pept        437630..438127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0392"
FT                   /product="lipoprotein signal peptidase"
FT                   /note="TIGRFAM: lipoprotein signal peptidase; PFAM:
FT                   peptidase A8 signal peptidase II; KEGG: met:M446_2219
FT                   lipoprotein signal peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55434"
FT                   /db_xref="GOA:B8IB41"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8IB41"
FT                   /inference="protein motif:TFAM:TIGR00077"
FT                   /protein_id="ACL55434.1"
FT                   /translation="MRPLPFGLLVAAATLVLDQATKLGLLFLTDLPIRQPIVLAPFAQL
FT                   VVVWNRGVSYGLFQQHTELGRWLLVAVSVLAAVALTAWMARTGTRLLAGALGLIVGGAI
FT                   GNAIDRIAYGAVFDFVHLHAGGWSWYVFNVADAGIVLGVAGLLYDAVRAERRNAREIRS
FT                   DA"
     atgcgccccc ttcccttcgg ccttctcgtc gcggcggcga cgctcgtcct cgaccaggcg        60
     acgaagctcg gcctcctgtt cctcactgac ctcccgatcc gccagccgat cgtgctcgct       120
     cccttcgcgc agctcgtcgt ggtctggaat cgcggggtgt cctacggcct cttccagcag       180
     cacaccgaac tcgggcgctg gctgctcgtg gcggtctcgg tcctcgccgc cgtggccctc       240
     acggcctgga tggcgcggac gggcacgcgg ctcctcgccg gcgcgctcgg tctgatcgtc       300
     ggcggggcga tcggcaacgc catcgaccgc atcgcctacg gggcggtgtt cgacttcgtc       360
     cacctgcatg cgggcggctg gtcctggtac gtgttcaacg tcgcggatgc gggcatcgtc       420
     ctcggcgtcg ccgggctgct ctacgacgcg gtccgggccg agaggcggaa cgcccgggag       480
     atccgctccg acgcctga                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page