(data stored in ACNUC7421 zone)

EMBL: CP001349.PE383

CP001349.PE383       Location/Qualifiers
FT   CDS_pept        438269..438931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0393"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2218 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55435"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB42"
FT                   /inference="similar to AA sequence:KEGG:M446_2218"
FT                   /protein_id="ACL55435.1"
FT                   /translation="MRNQRTILALTAILCGAAPGAQAEDGVFMKKALSSIGLIEPERPT
FT                   ITYRERAPLVLPPKMDKAALPPPVPRSAVREVAPQWPTDPEAVARARRAEDDRKPRGMR
FT                   GEQGRMSDNNTTLSIHEMRGGRREGAGIPKEPVYKPGDNVREATWLSPLELFKGRKDED
FT                   ATPSDVEPSRDMLTDPPTGYRAPPGGRLVRSDSGPKGMPISDREEADPRAYLRSRQQ"
     atgagaaacc agcgcacgat cctcgccctc acggcgatcc tctgcggcgc ggcgccgggc        60
     gcccaggcgg aggacggcgt gttcatgaag aaggcgctgt cgtccatcgg gctgatcgag       120
     ccggagcggc cgaccatcac ctaccgcgag cgggcccccc tcgtgctgcc gccgaagatg       180
     gacaaggccg cgctgccgcc gccggtgccg cgcagcgccg tgcgggaggt ggccccgcaa       240
     tggccgaccg atcccgaggc cgtcgcccgc gcgcgccggg ccgaggacga ccgcaagccg       300
     cggggcatgc gcggcgagca gggccgcatg agcgacaaca acaccacgct gtcgatccac       360
     gagatgcggg gaggccgccg cgagggcgcc ggcatcccga aggagccggt ctacaagccg       420
     ggcgacaacg tgcgcgaggc gacctggctc agccccctgg agctgttcaa gggccgcaag       480
     gacgaggacg cgacgccctc ggacgttgag ccgagccgcg acatgctgac cgatccgccc       540
     accggctacc gcgcgccgcc gggcggcagg ctcgtccgct cggatagcgg ccccaagggc       600
     atgccgatca gcgaccgcga agaggccgat ccgcgcgcct acttgcgctc gcggcagcag       660
     tga                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page