(data stored in ACNUC7421 zone)

EMBL: CP001349.PE384

CP001349.PE384       Location/Qualifiers
FT   CDS_pept        439218..440597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0394"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   met:M446_2217 peptidase M16 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55436"
FT                   /db_xref="GOA:B8IB43"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB43"
FT                   /inference="protein motif:PFAM:PF05193"
FT                   /protein_id="ACL55436.1"
FT                   /translation="MHSRTRPLLRPTDRPGPALRLDAAPYGRAEAGGPEVASFTLDNGL
FT                   DVVVIPDHRAPVATHMIWYRNGSADDPLGQSGIAHFLEHLMFKGTAKHPAGAFSKAVSS
FT                   LGGQENAFTSFDYTAYFQRVARDNLKTMMEFEADRMTGLVLDDAVVAPERDVVLEERRM
FT                   RVETDPSAQLSEAMAASLFVHHPYGIPIIGWMHEIEELNRTHALAYYQRFYTPENAILV
FT                   VAGDVTGDEVRRLAEATYGQVAPRGERPVRLRPREPEPRAARRLSVADPKVEQPTLQRL
FT                   YLTPSCITAKDGEGHALELLAEVMGGGPTSYLYRSLVMEQGVAVNAGAWYMGSAMDDTR
FT                   FSVYAVPAEGVSLERLEEALDRALRRLPAEALAPEAVERAKTRLVAETVYSSDSQSSLA
FT                   RIYGSALAIGESIEEVRRWPADIEAVEADRLATAAERYLTPARSVTGYLTKAREADAAV
FT                   A"
     atgcattcca ggacgcgccc tctcctccgc ccgaccgaca gacccggccc cgccctgcgc        60
     ctcgatgcgg cgccgtacgg gcgggccgag gcgggcgggc ccgaggtcgc gtccttcacc       120
     ctcgacaacg gcctcgacgt ggtcgtcatc cccgaccacc gggcgcccgt cgccacccac       180
     atgatctggt accgcaacgg ctcggccgat gatccgctcg gccagtccgg catcgcgcat       240
     ttcctcgagc acctgatgtt caagggcacc gcgaagcacc cggcgggcgc cttctcgaag       300
     gcggtgtcga gcctgggcgg ccaggagaat gccttcacgt ctttcgacta cacggcctat       360
     ttccagcgcg tcgcccgcga caacctgaag accatgatgg aattcgaggc cgaccggatg       420
     accggcctcg tcctcgacga cgccgtggtg gcgcccgagc gcgacgtggt gctggaggag       480
     cgccgcatgc gggtcgagac cgacccgagc gcgcagctct ccgaggccat ggccgcctcg       540
     ctcttcgtcc accaccccta cggcatcccg atcatcggct ggatgcacga gatcgaggag       600
     ctgaaccgca cccatgcgct cgcctattac cagcgcttct acacccccga gaacgcgatc       660
     ctggtggttg ccggcgacgt gaccggcgac gaggtgcggc gcctcgccga ggcgacctac       720
     gggcaggtcg cgccccgcgg cgagcggccg gtgcgcctgc ggccccgcga gccggagccc       780
     cgcgcggccc ggcggctcag cgtcgcggat ccgaaggtcg agcagccgac gctccagcgc       840
     ctctacctca ccccgtcctg catcaccgca aaggacggcg agggtcacgc gctcgaactc       900
     ctcgccgagg tgatgggcgg cggcccgacc tcctatctct accgctcgct ggtgatggag       960
     cagggcgtcg cggtgaatgc cggggcctgg tacatgggct cggccatgga cgacacccgc      1020
     ttctcggtct acgccgtgcc ggccgagggc gtgtccctcg agaggctgga ggaggcgctc      1080
     gaccgggcgc tgcggcgcct gcccgccgag gcgctggccc ccgaggcggt ggagcgcgcc      1140
     aagacccggc tcgtcgccga gacggtctat tcctcggaca gccagtcctc gctcgcccgc      1200
     atctacggct cggcgctcgc catcggcgag agcatcgagg aggtgcgccg ctggcccgcc      1260
     gacatcgagg ccgtggaggc ggaccggctc gcgactgcgg ccgagcgcta tctcaccccg      1320
     gcccgctccg tgaccggcta tctgacgaag gcccgcgagg ccgatgcggc cgtcgcctga      1380
//

If you have problems or comments...

PBIL Back to PBIL home page