(data stored in ACNUC7421 zone)

EMBL: CP001349.PE385

CP001349.PE385       Location/Qualifiers
FT   CDS_pept        440641..441954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0395"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   met:M446_2216 peptidase M16 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55437"
FT                   /db_xref="GOA:B8IB44"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB44"
FT                   /inference="protein motif:PFAM:PF05193"
FT                   /protein_id="ACL55437.1"
FT                   /translation="MTLADAATRTAALATPSSPAKARSVIAASGVEAWHVESPVVPLVA
FT                   LAFTFEGGAAQDPEGKSGAVQMLSRLLDEGAGPYGSDAFQERLAARAIELNFHAGPDAV
FT                   GGSLKMLVKHADEAIELLALALAEPRFDEAAVERVRAQMLAGIRYQQNDPGVMASRRFF
FT                   SEAYPGHPYGRPSGGTLESVASITRDDLVALHRRLISRARVKVAAVGAIGEAALQRALD
FT                   AAFGPLSEGGPLAEVPPTRIAGLGTAGSGRRIVVDLDVPQSVIRFGADGVPWRDPDFIP
FT                   AYVLNHILGGGAFTSRLFQEVREKRGLAYSVGTSLVSHRAASMVWGYTATKNERVAEAL
FT                   SVIGEEIARLTRDGPSDEELQKAKDYLTGSYALGFDTSTKIAHQLVQVAFEGLGIDYIS
FT                   RRNGLIAAVTQDDIRRAAARTLGDGRLLVVAAGRPTEI"
     atgaccctgg ccgacgccgc cacccggacc gccgccctcg ccaccccctc ctccccggcc        60
     aaggcccggt ccgtgatcgc cgcgagcggt gtcgaggcgt ggcacgtcga gtcccccgtc       120
     gtcccgctgg tcgcgctcgc cttcaccttc gagggcggtg ccgcccagga cccggagggc       180
     aagtccggcg cggtgcagat gctgtcgcgc cttctcgacg agggcgccgg cccctacggc       240
     tcggacgcct tccaggagcg gctcgcggcg cgggcgatcg agctcaattt ccatgccggg       300
     cccgacgcgg tcggcggctc gctcaagatg ctggtcaagc acgcggacga ggcgatcgag       360
     cttctggcac tcgccctcgc cgagccccgc ttcgacgagg cggcggtcga gcgcgtgcgc       420
     gcgcagatgc tggcggggat ccgctaccag cagaacgacc ccggcgtgat ggcctcccgc       480
     cgcttcttct ccgaggccta tccgggccat ccctatggcc gcccctccgg cggcacgctc       540
     gagagcgtgg cgagcatcac tcgcgacgac ctcgtggcgc tgcaccgccg gctgatcagc       600
     cgcgcgcggg tcaaggtcgc ggcggtgggc gcgatcggcg aggcggcgct gcagcgcgcc       660
     ctcgacgcgg ccttcgggcc tctctccgag ggcggcccgc tcgccgaggt gccgccgacc       720
     cggatcgcgg gcttgggcac cgcgggctcg ggccggcgga tcgtggtcga tctcgacgtg       780
     ccgcaatcgg tgatccgctt cggcgccgac ggcgtgccgt ggcgcgaccc ggacttcatc       840
     ccggcctatg tgctcaacca tatcctgggc ggcggcgcct tcacgtcgcg gctgttccag       900
     gaggtgcgcg agaagcgcgg cctcgcctat tcggtcggca cctcgctggt gagccaccgc       960
     gccgcctcga tggtctgggg ctacacggcc accaagaacg agcgcgtggc cgaggcgctg      1020
     tcggtgatcg gggaggagat cgcgcggctc acccgcgacg ggccctccga cgaggagctg      1080
     cagaaggcca aggactacct gaccggctcc tacgcgctcg gcttcgacac ctcgacgaag      1140
     atcgcccacc agctcgtcca ggtggccttc gaggggctcg gcatcgacta tatcagccgc      1200
     cgcaacggcc tgatcgccgc cgtgacccag gacgacatcc gccgcgccgc cgcgcgcacc      1260
     ctcggcgacg gccgcctcct ggtggtggcc gccggccggc cgacggagat ctga            1314
//

If you have problems or comments...

PBIL Back to PBIL home page