(data stored in ACNUC7421 zone)

EMBL: CP001349.PE386

CP001349.PE386       Location/Qualifiers
FT   CDS_pept        complement(442080..442517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0396"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   met:M446_2215 cupin 2 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55438"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017102"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB45"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ACL55438.1"
FT                   /translation="MSDVVDSPTCRVVRAGDAFVGKQALTYAPGISAESVGSRGIHLQT
FT                   VTMPPGARARAHLHEGHETALHVLSGVAGMWYGPRLEHHMWNRAGDYVYIPAGVPHLPY
FT                   NASRTETCIAVIARTDPNEQESVVLLPELDEVRPAGEDPMA"
     atgtccgacg tcgtcgactc tcccacctgc cgcgtcgtcc gcgcgggcga cgcgttcgtg        60
     ggcaagcagg ccctgaccta tgcgccgggg atctcggccg aatcggtcgg gtcgcgcggc       120
     atccatctcc agaccgtgac catgccgccc ggcgcccggg cgagggcgca tctgcacgag       180
     gggcacgaga cggccctgca tgtgctgagc ggggtcgccg gcatgtggta cgggccgcgc       240
     ctggagcatc acatgtggaa ccgggccggc gattacgtct acatcccggc cggcgtgccg       300
     cacctgccct acaatgccag ccgcaccgag acctgcatcg ccgtgatcgc gcgcacggac       360
     ccgaacgagc aggagagcgt ggtgctgttg ccggagctgg acgaggtgcg gccggccggt       420
     gaggacccga tggcctga                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page