(data stored in ACNUC7421 zone)

EMBL: CP001349.PE387

CP001349.PE387       Location/Qualifiers
FT   CDS_pept        442613..443455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0397"
FT                   /product="Urease accessory protein UreD"
FT                   /note="PFAM: Urease accessory protein UreD; KEGG:
FT                   met:M446_2214 urease accessory protein UreD"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55439"
FT                   /db_xref="GOA:B8IB46"
FT                   /db_xref="InterPro:IPR002669"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB46"
FT                   /inference="protein motif:PFAM:PF01774"
FT                   /protein_id="ACL55439.1"
FT                   /translation="MSSPAPWPQRQRSDGRVMLVAGRMPGGATRLTDLAESGPLRLRLP
FT                   QMAGGALEGVFLNSAGGIACGDRFAIAADLAPGADLVLTTTAAEKIYRSDGPVTEIAAD
FT                   LRVAEGARLAWLPQETILYDGARLRRRLTAELAPGATLTLFEALVFGRAARGETVSEGL
FT                   LHDVWRLSRAGRLVYADTLRLDGPIADQMARPAIAGGARALATLIHVAADAEARLEEMR
FT                   ALIETAGCEGLGIEAGASAWNGLLAVRLLARGIGPLRQAATRILEGFRGVPLPRVWQT"
     atgtcctccc ctgccccctg gccgcagcgc cagcgctccg acggccgcgt catgctcgtc        60
     gccggccgga tgccgggcgg cgcgacccgc ctgacggacc tcgccgagag cggcccctta       120
     cgcctgcgcc tgccgcagat ggcgggcggc gcgctcgaag gcgtcttcct caacagcgcg       180
     ggcgggatcg cctgcggcga ccgtttcgcc attgcggcgg atctcgcccc gggggcggac       240
     ctcgtcctca ccaccacggc ggcggagaag atctaccgct cggacggccc cgtgaccgag       300
     atcgcggcgg atctccgggt ggcggagggc gcccggctcg catggctgcc gcaggagacg       360
     atcctgtatg acggcgcgcg gctgcggcgg cgcctcacgg cggagcttgc tcccggcgcg       420
     accctgaccc tgttcgaggc gctggtcttc ggccgcgccg cccggggcga gaccgtgagc       480
     gagggcctcc tccacgacgt ctggcggctg tcccgggcgg gccgcctcgt ctatgccgac       540
     acgcttcgcc tggacggccc catcgccgac cagatggccc ggccggcgat cgccggcggg       600
     gcccgggcgc tcgcgaccct gatccatgtc gcggccgatg ccgaggcgcg gctcgaggag       660
     atgcgggcgc tgatcgagac ggcgggatgc gagggcctcg gcatcgaggc cggggcgagc       720
     gcctggaacg gcctgcttgc ggttcgcctg ctcgcccgcg ggatcggccc cctgcggcag       780
     gccgcgacgc ggatcctcga aggattccgc ggggttccgc tgccccgcgt ctggcagacc       840
     tga                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page