(data stored in ACNUC7421 zone)

EMBL: CP001349.PE388

CP001349.PE388       Location/Qualifiers
FT   CDS_pept        443534..444154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0398"
FT                   /product="urease, gamma subunit"
FT                   /EC_number="3.5.1.5"
FT                   /note="TIGRFAM: urease, beta subunit; urease, gamma
FT                   subunit; PFAM: Urease beta subunit; Urease gamma subunit
FT                   region; KEGG: met:M446_2213 urease, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55440"
FT                   /db_xref="GOA:B8IB47"
FT                   /db_xref="InterPro:IPR002019"
FT                   /db_xref="InterPro:IPR002026"
FT                   /db_xref="InterPro:IPR008223"
FT                   /db_xref="InterPro:IPR012010"
FT                   /db_xref="InterPro:IPR036461"
FT                   /db_xref="InterPro:IPR036463"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB47"
FT                   /inference="protein motif:TFAM:TIGR00193"
FT                   /protein_id="ACL55440.1"
FT                   /translation="MLLTPREKDKLLVAMAAQVARNRLARGVKLNFPEAVALITDFVVE
FT                   GARDGRTVAELMQAGAQVLDASQVMEGVPEMIHDIQVEATFPDGTKLVTVHHPIRGAPS
FT                   AEVPGAVTTPPGEIVFNAGAPRTVIEVANTGDRPIQVGSHYHFFEVNPALHFDREKARG
FT                   QRLDIAPGTAVRFEPGATREVTLVPMGGAREVYGFRGDVMGQL"
     gtgctgttga ccccccgcga gaaggacaag ctcctcgtcg ccatggcggc ccaggtggcc        60
     cgcaaccgtc tggcccgggg cgtgaagctc aacttccccg aggcggtggc gctcatcacc       120
     gatttcgtgg tcgagggcgc ccgcgacggg cgcaccgtgg ccgagctgat gcaagccggc       180
     gcgcaggtgc tcgacgcctc ccaggtgatg gagggcgtgc cggagatgat ccacgacatc       240
     caggtcgagg cgaccttccc ggacggcacc aagctcgtga cggtgcacca cccgatccgg       300
     ggcgcgcctt ccgccgaggt gccgggcgcc gtgacgacgc ccccaggcga gatcgtgttc       360
     aacgcgggcg ccccgcgcac cgtgatcgag gtggccaata ccggcgaccg gccgatccag       420
     gtcggctccc actaccattt cttcgaggtg aacccggcgc tccacttcga ccgggagaag       480
     gcccgcggcc agcgcctcga catcgcgccc ggcacggcgg tgcgcttcga gccgggcgcg       540
     acccgcgagg tgacgctggt gccgatgggc ggcgcccggg aagtgtacgg cttccgcggc       600
     gacgtgatgg gtcagctctg a                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page