(data stored in ACNUC7421 zone)

EMBL: CP001349.PE389

CP001349.PE389       Location/Qualifiers
FT   CDS_pept        444188..445915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0399"
FT                   /product="urease, alpha subunit"
FT                   /EC_number="3.5.1.5"
FT                   /note="TIGRFAM: urease, alpha subunit; PFAM:
FT                   amidohydrolase; Urease alpha-subunit domain protein;
FT                   Amidohydrolase 3; KEGG: met:M446_2211 urease, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55441"
FT                   /db_xref="GOA:B8IB48"
FT                   /db_xref="InterPro:IPR005848"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011612"
FT                   /db_xref="InterPro:IPR017950"
FT                   /db_xref="InterPro:IPR017951"
FT                   /db_xref="InterPro:IPR029754"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB48"
FT                   /inference="protein motif:TFAM:TIGR01792"
FT                   /protein_id="ACL55441.1"
FT                   /translation="MSNTPKPASLPRAAYAGMFGPTKGDRIRLADTCLVIEVEHDHTRY
FT                   GEEVKFGGGKVIRDGMGQGQASNAAGAVDTVITNAVVLDHWGIVKCDVGLTGGRIAALG
FT                   KAGNPDIQDGVTIVVGPGTEVIAGEGKILTAGGFDSHIHYICPQQIEEALNSGVTTMLG
FT                   GGTGPAHGTFATTCTPGPWHIARMIEAADAFPMNLAFAGKGNASRPESLEEMIRAGACA
FT                   LKLHEDWGTTPAAIDCCLTVADSHDVQVMIHTDTLNESGFVEDTIAAFKGRTIHAFHTE
FT                   GAGGGHAPDIIKVAGLPNVLPSSTNPTRPYTRNTIDEHLDMLMVCHHLSPAIPEDLAFA
FT                   ESRIRKETIAAEDILHDLGALSIMSSDSQAMGRVGEVVIRTWQTADKMKRQRGALPGDS
FT                   AGNDNLRARRYVAKYTINPAIAHGVAKHIGSVEPGKLADLVLWSPAFFGVKPDLVIKGG
FT                   AIATAPMGDPNASIPTPQPVHYRPMFGAFGRVPATTSLTFVSKAAVEAGLRDRLRVQKD
FT                   LVAVENVRGGIGKRSMILNDATPVIEVDPETYDVRADGQLLVCEPAEVVPMAQRYFLF"
     gtgtccaaca cgcccaaacc cgcgagcctg ccccgcgccg cctatgcggg catgttcggc        60
     ccgaccaagg gcgaccgcat ccggctcgcc gatacctgcc tcgtcattga ggtcgagcac       120
     gaccacaccc gctacggcga ggaggtgaag ttcggcggcg gcaaggtgat ccgcgacgga       180
     atgggccagg ggcaggcgag caacgccgcc ggtgccgtcg acaccgtgat caccaatgcg       240
     gtcgtcctcg atcattgggg catcgtgaaa tgcgatgtcg gcctgacagg cgggcgcatc       300
     gcggcgctcg gcaaggccgg caatccggac attcaggacg gcgtcaccat cgtggtcggg       360
     cccggcaccg aggtaatcgc gggcgagggc aagatcctca ctgcgggcgg cttcgacagc       420
     cacatccact acatctgccc gcagcagatc gaggaggcac tgaattccgg cgtcaccacg       480
     atgctgggcg gcgggacggg cccggcgcat ggcaccttcg ccaccacctg cacgcccggc       540
     ccctggcaca tcgcccggat gatcgaggcc gccgacgcct tcccgatgaa cctggccttc       600
     gccggcaagg gaaatgcctc acggcccgag agcctggagg agatgatccg ggcgggcgcc       660
     tgcgcgctca agctgcacga ggattggggc acgacgcccg ctgcgatcga ttgctgcctt       720
     acggtcgcgg attcccacga cgtgcaggtc atgatccaca ccgacacgct caacgaatcg       780
     ggcttcgtcg aggacacgat cgcggccttc aagggccgca ccatccatgc cttccacacc       840
     gagggggccg gcggcgggca cgcgcccgac atcatcaagg tggcggggct tccgaacgtg       900
     ctgccctcct ccaccaaccc gacccggccc tacacgcgca acaccatcga cgagcatctc       960
     gacatgctga tggtgtgcca tcacctgtcg cccgcgatcc ccgaggatct cgccttcgcg      1020
     gagagccgca tccgcaagga gacgatcgcg gccgaggaca tcctgcacga tctcggcgcc      1080
     ctctcgatca tgtcctcgga cagccaggcc atgggccgcg tcggcgaggt ggtgatccgc      1140
     acatggcaga ccgccgacaa gatgaagcgc cagcgcggcg ccctgccggg cgattcggcc      1200
     ggcaatgaca acctgcgcgc ccggcgctac gtggcgaagt acacgatcaa cccggcgatc      1260
     gcgcacggcg tggcgaagca catcggctcg gtcgagccgg gcaagctcgc cgacctcgtc      1320
     ctgtggtcgc ccgccttctt cggcgtgaag cccgacctcg tcatcaaggg cggcgccatc      1380
     gcgacggcgc cgatgggcga cccgaacgcc tcgatcccga cgccccagcc ggtgcattac      1440
     cggccgatgt tcggcgcctt cggccgggtg cccgccacca cctccctcac cttcgtgtcg      1500
     aaggcggcgg tcgaagcggg cctgcgcgac cggctgcgcg tgcagaagga cctcgtcgcg      1560
     gtcgagaacg tgcgcggcgg catcggcaag cgcagcatga ttctcaacga cgccacgccg      1620
     gtgatcgagg tcgatcccga gacctacgac gtgcgggcgg acgggcagct cctcgtctgc      1680
     gagcccgccg aggtggtgcc gatggcgcag cggtattttc tcttctga                   1728
//

If you have problems or comments...

PBIL Back to PBIL home page