(data stored in ACNUC7421 zone)

EMBL: CP001349.PE39

CP001349.PE39        Location/Qualifiers
FT   CDS_pept        complement(42670..43782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0040"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="SMART: regulatory protein LuxR; KEGG: met:M446_0039
FT                   LuxR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55091"
FT                   /db_xref="GOA:B8IT29"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT29"
FT                   /inference="protein motif:SMART:SM00421"
FT                   /protein_id="ACL55091.1"
FT                   /translation="MAEVREDRLAATIDLFYEAAMQPERWPSALEAYGEALGADGALML
FT                   TGPEAPLSPTISEGVAEIVAIGLRDGWLADNPRIARGIPALINDPQGVVTESHLFTPQE
FT                   LDEIPFNAEYVARYGFRWFAGAYLVPDGNRSVILSAERRREREMYSHREIEQIERAVPH
FT                   LQRAGQIAVRLAEARAHATLDAFEMMHCGAFLLDSSGAVLRMNPQAERHLGGGLAVVKG
FT                   ALLAQHRAANADLGRLIASAIHPGKPHEAPPLGALAVPRPEGPPLVLHAAPLARTTNDI
FT                   FQRARAIIVVTDSAAGQKPGEALLRQAYGLTAAEARLANDLADGADLARVAAGLGITVA
FT                   TARTQLKAVFAKTGTHRQPELVALLTRMRP"
     atggcggagg tgcgggaaga tcgtctcgcg gcgacgattg atctgttcta cgaagctgcg        60
     atgcagccgg agcgatggcc ctcggccctc gaagcctacg gcgaggccct gggggccgac       120
     ggggcgctga tgctgaccgg ccccgaggcg ccgctgtcgc cgaccatctc ggaaggcgtg       180
     gcggagatcg tggccatcgg cttgcgggac ggctggctgg ccgacaatcc ccgcatcgca       240
     cgcggcatcc cggcgctgat caacgatccg cagggagtcg tcaccgaatc ccacctcttc       300
     acgccgcagg agctcgatga gatcccgttc aacgcggagt atgtcgcccg ctacggcttc       360
     cgctggttcg ccggcgccta tctcgtgccg gacggcaacc gcagcgtcat cctctcggct       420
     gagcggaggc gcgagcggga gatgtactca catcgcgaga tcgagcagat cgagcgcgcc       480
     gtgccgcatc tccagcgcgc cggtcagatc gcggtgcggc tcgccgaggc gcgggcgcat       540
     gcgacgctcg acgcgttcga gatgatgcac tgtggcgcct ttctcctcga cagcagcggc       600
     gccgtgctgc gcatgaaccc gcaggccgag cggcatctcg gcggcggcct cgcggtggtc       660
     aagggcgcgc tgctcgcgca gcaccgcgcg gcgaatgcgg atctcgggcg cctcatcgcc       720
     agcgccattc atcccggcaa gccgcacgag gcaccgccgc tcggggccct ggcggtgccg       780
     cggccggagg ggccgcctct cgtgctccat gccgccccgc tcgcccggac cacgaacgac       840
     atcttccagc gcgcccgcgc catcatcgtg gtcacggatt ccgccgccgg gcagaagccc       900
     ggcgaggcgc tcctgcggca ggcctacggc ctgacggccg ccgaggcgcg gctcgccaac       960
     gatctggcgg atggggccga tctcgcgcgg gtcgcggccg gcctcgggat caccgtggcg      1020
     acggcgcgca cgcagctcaa ggcggtcttc gccaagaccg gcacgcaccg ccagccggaa      1080
     ctcgtcgccc tgctgacgcg gatgcggcca tag                                   1113
//

If you have problems or comments...

PBIL Back to PBIL home page