(data stored in ACNUC7421 zone)

EMBL: CP001349.PE390

CP001349.PE390       Location/Qualifiers
FT   CDS_pept        446092..447669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0400"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: met:M446_2210 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55442"
FT                   /db_xref="GOA:B8IB49"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB49"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACL55442.1"
FT                   /translation="MRSGLTRRMAVAFGAALVLAAGQAAAQDKRVLKAVMHSGLRITDP
FT                   IITTAYIARNHGYMIYDTLFATDERFEIRPQMVKDYSVSDDKLTYTFTLRDGLKFHDGT
FT                   PVTAEDCIASIERWGKRDGMGQKLMEYTTAMKAVGDKTFTLTLKQPYGLVLASLGKPSS
FT                   NVPFIMPKRIAETPADKNVPEEIGSGPFRFVKAEFQPGLKVVYEKNPDYVPRAEPPSWL
FT                   AGGKVVKLDRVEWINIPDYQTAVNALINGEIDYIEQPPHDFLPILKDAKGIVINNYNPL
FT                   GFSGMLRMNWLNPPFDNPKIRQAVLAAVNQQDYLDAQIGNPDYMQPCLAMFVCGTPNAT
FT                   DAGAPKLDPARAKQLLKEGGYDGRPIVIMQPTDLAIVAPLGPVTAQALRNIGMKVDLQS
FT                   MDWQTLVGRRAKQDPVDQGGWNIFHTTWVNADMLNPIANVGVNGKGKQGGWFGWAEDKE
FT                   IEAMRDAYARETDPAKQKLIAADVQKRAYEIGMYFPTGQYTSPLAVRSSLKGILQGPAP
FT                   VFWNIEKQ"
     atgcggtcgg gtctgacgag acggatggcg gttgccttcg gggcggccct ggtgctggcg        60
     gccggtcagg ccgccgcgca ggacaaacgc gtgctcaagg ccgtgatgca ttcgggcctg       120
     cgcatcaccg acccgatcat caccaccgcc tacatcgccc gcaaccacgg ctacatgatc       180
     tacgacacgc tcttcgccac ggacgagcgt ttcgagatca ggccgcagat ggtgaaggac       240
     tattccgtca gtgacgacaa gctgacctat accttcacgc tgcgcgatgg gctgaaattc       300
     catgacggca cgccggtcac ggcggaggac tgcatcgcct cgatcgagcg ctggggcaag       360
     cgcgacggca tgggccagaa actcatggaa tacaccacgg ccatgaaggc cgtgggcgac       420
     aagaccttca cgctgaccct gaagcagccc tacggcctcg tgctcgcctc gctcggcaag       480
     ccgtcgtcga acgtgccctt catcatgccc aagcgcatcg ccgagacgcc ggccgacaaa       540
     aacgtgccgg aggagatcgg ctcggggcca ttccgcttcg tcaaggccga gttccagccc       600
     ggcctcaagg tcgtctacga gaagaatccc gactacgtgc cccgcgccga gccgccgagc       660
     tggctcgccg gcggcaaggt cgtcaagctc gaccgggtcg agtggattaa catccccgac       720
     taccagaccg ccgtgaatgc cctcatcaat ggcgagatcg actacatcga gcagccgccg       780
     cacgacttcc tgccgatcct gaaggatgcc aagggcatcg tcatcaacaa ctacaacccg       840
     ctcggcttct ccggcatgct ccggatgaac tggctcaacc cgcccttcga caacccgaag       900
     atccggcagg cggtgctcgc cgcggtcaac cagcaggact atctcgacgc gcagatcggc       960
     aacccggact acatgcagcc ctgcctggcg atgttcgtct gcggcacgcc gaacgcgacc      1020
     gatgcggggg cgccgaagct cgacccggca cgggccaagc agctcctcaa ggagggcggc      1080
     tatgacgggc ggcccatcgt gatcatgcag ccgacggacc tcgccatcgt ggcgccgctc      1140
     ggcccggtga ccgcgcaggc tttgcgcaat atcggcatga aggtcgacct gcagtcgatg      1200
     gactggcaga cgctggtcgg gcgccgcgcc aagcaggatc cggtggacca gggcggctgg      1260
     aacatcttcc acaccacctg ggtcaatgcc gacatgctca accccatcgc caatgtcggg      1320
     gtgaacggca agggcaagca gggcggctgg ttcggctggg ccgaggacaa ggagatcgag      1380
     gcgatgcggg acgcctatgc ccgcgagacc gatcccgcca agcagaagct catcgccgcc      1440
     gacgtgcaga agcgggccta cgagatcggc atgtacttcc cgaccgggca gtacacctcg      1500
     ccgctcgcgg tgcgcagctc cctgaagggc atcctgcagg ggccggctcc ggtgttctgg      1560
     aacatcgaga agcagtga                                                    1578
//

If you have problems or comments...

PBIL Back to PBIL home page