(data stored in ACNUC7421 zone)

EMBL: CP001349.PE391

CP001349.PE391       Location/Qualifiers
FT   CDS_pept        447677..448618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0401"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: met:M446_2209
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55443"
FT                   /db_xref="GOA:B8IB50"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB50"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL55443.1"
FT                   /translation="MLRFVAGRLVATLPVMGVVAVVVFGLLRLAPGDPAAILAGDAATP
FT                   EQIAAIRARLGLDEPMLQQFVSWLWRLLHGDLGTSIISNQPVTRLIGERIEPTLALATT
FT                   TILFAVLVAVPLGVVAAWRHGTWIDRAVMAFSVLGFSVPVFVLGYLWIFGAALKLGLLP
FT                   VQGYVSIREGFGPFIERLILPTLTLSVIYIALIARTTRASVLEVLGEDYIRTARAKGLR
FT                   ERRVLTRHALRNAAVPVISVIGLGIALLISGVVVTESVFNLPGLGRLTVDAVLARDYPV
FT                   IQGVILLFSGFYVLINLAIDLTYLFFDPRIRY"
     atgctccgct tcgtcgccgg acggctcgtc gccaccctcc cggtgatggg cgtggtggcg        60
     gtggtggtgt tcgggttgct gcggctcgcc cccggggatc ccgcggcgat cctcgcgggc       120
     gacgcggcga ccccggagca gatcgccgcg atccgggccc ggctcggcct cgacgagccg       180
     atgctgcagc aattcgtctc ctggctctgg cgcctcctgc atggggatct tggcacctcg       240
     atcatctcga accagccggt gacgcggctg atcggcgagc gcatcgagcc cacgctcgcg       300
     ctcgccacga ccacgatcct gttcgcggtt ctggtggcgg tgccgctcgg ggtggtggcc       360
     gcatggcgcc acggcacgtg gatcgaccgg gcggtgatgg ccttctcggt gctcggcttc       420
     tcggtgccgg tcttcgttct gggctatctc tggatcttcg gcgccgccct caagctcggg       480
     cttctgccgg tgcaaggcta tgtcagcatc cgcgaggggt tcggcccctt catcgagcgg       540
     ctcatcctgc cgacgctgac cctctcggtg atctacatcg ccctcatcgc gcgcacgacg       600
     cgggcgagcg tgctggaggt gctgggggag gactatatcc gcaccgcgcg ggccaagggg       660
     ctgcgcgagc gccgggtgct cacccgccat gcgctgcgca acgccgccgt cccggtgatc       720
     tcggtgatcg gccttggcat cgcgctcctg atcagcgggg tcgtcgtcac cgagagcgtg       780
     ttcaacctgc cggggctcgg acgcctcacc gtcgatgcgg tgctcgcccg cgactacccg       840
     gtgatccagg gcgtgatcct gctcttctcg gggttctacg tgctgatcaa cctcgcaatc       900
     gacctcacct acctcttctt cgacccgagg atccgctatt ga                          942
//

If you have problems or comments...

PBIL Back to PBIL home page