(data stored in ACNUC7421 zone)

EMBL: CP001349.PE392

CP001349.PE392       Location/Qualifiers
FT   CDS_pept        448615..449487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0402"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: met:M446_2208
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55444"
FT                   /db_xref="GOA:B8IB51"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB51"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL55444.1"
FT                   /translation="MSASIAAAPRPRRLPPALRHPGVLFGLAVLLLVLVAALAAPWLGT
FT                   VDPIQLRPRLRLRPPSAAAWLGTDAFGRDVYSRVVYGARVSLAIGGAVAAIAVAAGLAI
FT                   GLVAGYIRWLDAVVMRVMDGVMAIPSILLAIALVTLSGAGIGTVIVAITIPEIPRVARL
FT                   VRGVVLTVREEPYVEAAIGAGTRLPLLLLRHVLPNTVAPLIVQGTYVCASAILTEAILS
FT                   FLGAGIPTEVPSWGNIMAEGRQAFQLAPWVILFPGLCVAATVLAVNILGDGLRDALDPR
FT                   LARRLGGVR"
     ttgagcgcgt cgatcgcggc agccccccgc ccccgccgcc tcccgccggc cctgcgccat        60
     ccgggcgtgc tgttcggcct cgcggtgctc ctcctggtgc tggtggcggc cctcgccgcc       120
     ccctggctcg gcacggtcga cccgatccag ctccgccccc gcctgcgcct gcgcccgccc       180
     tccgccgccg cctggctcgg caccgacgcc ttcgggcgcg acgtctacag ccgggtcgtc       240
     tacggagcgc gggtctccct cgccatcggg ggcgcggtgg cggcgatcgc ggtggcggcg       300
     ggcctcgcga tcgggctcgt cgccggctac atccgctggc tcgacgccgt ggtgatgcgg       360
     gtgatggacg gcgtcatggc gatcccgtcg atcctgctcg ccatcgcgct cgtcaccctg       420
     tcgggcgcag ggatcggcac ggtgatcgtc gccatcacca tcccggagat cccccgcgtc       480
     gcgcggctgg tgcgcggcgt ggtgctcacc gtgcgggagg agccctatgt cgaggcggcg       540
     atcggggccg gcacccggct gccgctcctg ctcctgcgcc acgtcctccc gaacaccgtc       600
     gcgccgctga tcgtccaggg cacctatgtc tgcgcctcgg cgatcctcac ggaggcgatc       660
     ctgagcttcc tcggggccgg catccccacc gaggtgccga gctggggcaa catcatggcg       720
     gaggggcgcc aggccttcca gctcgccccc tgggtgatcc tgttcccggg cctctgcgtc       780
     gccgcgacgg tgctcgcggt caacatcctg ggcgacggcc tgcgcgacgc cctcgacccg       840
     cgcctcgccc gccgtctcgg aggcgtccga tga                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page