(data stored in ACNUC7421 zone)

EMBL: CP001349.PE393

CP001349.PE393       Location/Qualifiers
FT   CDS_pept        449484..451136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0403"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase; KEGG: met:M446_2207 ABC transporter
FT                   related"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55445"
FT                   /db_xref="GOA:B8IB52"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB52"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL55445.1"
FT                   /translation="MTAPVLEIRDLAIPLPLRADRAYAVEGVSLAVAPGEILCVVGESG
FT                   SGKSVTAHAVMGLLPPVLKPSRGEILLQGEDVLKATPARLRGLRGGRMAMVFQEPMTAL
FT                   NPVLTVGAQIDEILEAHADRLGAAERRARVIALMRDVHLPDPERMAGAYPHQLSGGQRQ
FT                   RVMIAMALANDPALIIADEPTTALDVTTQAQILRLLRELQARREAGILFITHDFGVVAE
FT                   IADRVAVMQGGRLVEAGPAREVLHHPQDPYTRMLIAAVPSATPPPPRQRPAAQAPVLTV
FT                   RDLEKTYGGSLFSRAGRHVRALDGVSLALKPGETLGIVGESGSGKSTLARCIARFVDPS
FT                   SGEIRLDGTDIARLSDRALHPYRRRVQVIFQDPYRSLNPRRTVGQSITEGPRNYGMARD
FT                   EALARARRLIGLVGLDADALDRFPHEFSGGQRQRIAIARALAMEPDLLIADEAVSALDV
FT                   SVQAQVLDLLEEVRERLNLAILFITHDLRVAARLCDHLIVMLNGRVVEEGETAALFSDP
FT                   RHDYTKALFAAAPGASALRPEAGPRAANAAPPQ"
     atgaccgcgc ccgtgctgga gatccgggat ctggccatcc cgctgccgct gcgcgccgac        60
     cgggcctacg cggtcgaggg cgtctcgctc gcggtcgccc cgggcgagat cctctgcgtc       120
     gtcggcgagt cgggctcagg caagtcggtc acggcccatg cggtgatggg cctgctgccg       180
     cccgtcctga aaccatcgcg gggggagatc ctgctgcagg gcgaggacgt gctgaaggcc       240
     acgcccgccc gcctgcgggg cctgcgcggc ggccggatgg cgatggtgtt ccaggagccg       300
     atgacggcgc tgaacccggt gctgaccgtg ggggcgcaga tcgacgagat cctggaggcc       360
     catgccgacc ggctcggggc ggccgagcgc cgggcgcggg tgatcgcgct catgcgcgac       420
     gtgcacctgc ccgatcccga gcggatggcc ggcgcctatc cgcaccagct ctcgggcggg       480
     cagcgccagc gggtgatgat cgccatggcg ctcgccaacg atccggcgct gatcatcgcg       540
     gacgagccga cgaccgccct cgacgtgacg acccaggccc agatcctgcg cctcctgcgc       600
     gagctgcagg cgcggcgcga ggccgggatc ctgttcatca cccacgattt cggggtggtg       660
     gcggagatcg ccgaccgggt cgccgtgatg cagggcgggc gcctcgtcga ggcggggccg       720
     gcccgcgagg tgctgcatca cccgcaggat ccctataccc gcatgctgat cgccgcggtg       780
     ccctccgcga cgccgccccc gccgcgccag cgccccgccg cccaggcgcc cgttctcacc       840
     gtccgcgacc tggagaagac ctatggcggc agcctgttct cgcgggcggg gcgccatgtg       900
     cgcgccctcg acggggtcag cctcgcgctg aagcccgggg agacgctcgg gatcgtgggc       960
     gaatccggct ccggcaagtc gacgctcgcc cgctgcatcg cccgcttcgt cgatcccagc      1020
     tccggggaga tccgcctcga cggcaccgat atcgcccggc tgtcggaccg ggccctgcat      1080
     ccctaccggc ggcgcgtgca ggtgatcttc caggatccct accgctcgct gaacccgcgg      1140
     cgcacggtcg gccaatcgat caccgagggg ccgcgcaact acggcatggc gcgcgacgag      1200
     gccctggccc gcgcccgccg gctgatcggc ctcgtcgggc tcgatgccga cgcactcgac      1260
     cgcttcccgc acgaattctc gggcggacag cgccagcgca tcgccatcgc gcgggcgctc      1320
     gccatggagc cggacctgct cattgccgac gaggcggtct cggcactgga cgtctcggtg      1380
     caggcccagg tgctcgacct cttggaggag gtgcgcgagc ggctgaacct cgcgatcctg      1440
     ttcatcaccc acgacctgcg cgtggctgcg cgcctctgcg accacctgat cgtcatgctg      1500
     aacggccgcg tggtcgagga gggcgagacc gccgcgctct tttccgatcc gcgccacgac      1560
     tacacgaagg cgctcttcgc cgccgcgccg ggcgcgagcg cccttcggcc agaggcgggc      1620
     ccgcgcgccg cgaacgcggc gccgccgcaa tag                                   1653
//

If you have problems or comments...

PBIL Back to PBIL home page