(data stored in ACNUC7421 zone)

EMBL: CP001349.PE394

CP001349.PE394       Location/Qualifiers
FT   CDS_pept        complement(451314..451883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0404"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_0094 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55446"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB53"
FT                   /inference="similar to AA sequence:KEGG:M446_0094"
FT                   /protein_id="ACL55446.1"
FT                   /translation="MRTGSGAHPPVEGARGRRTSRVPHGLRFVRHRSAILIALALLTVP
FT                   PGSAPARVLSDGDLASVARIKPLFVDVLNDVSQSAQRADLSGADSDCLRSTLRALLQIS
FT                   EELKGYESLITIEGELVDFGDDATLKSVLRFAVENALKILDIERRRLGELSDQCARYPL
FT                   SAAKTRQALQFIDSTQAILRAVQPRL"
     atgcggacgg gatctggtgc gcacccccct gtcgagggcg ctcgcggccg gcgcacctcg        60
     cgcgtgccgc acgggctccg attcgtccgg caccggtccg cgatcctgat cgcactggcg       120
     ctgctgacgg ttccgcccgg ctccgcgccg gcccgggtgc tcagcgacgg cgatctcgcg       180
     agcgtcgcgc ggatcaagcc gctcttcgtc gacgtgctga acgacgtgtc gcaatccgcg       240
     cagcgcgcgg acctctcggg cgccgacagc gactgcctcc gctccaccct gcgcgccctg       300
     ctgcagatct ccgaggagct gaagggctac gagtcgctga tcaccatcga gggcgagctc       360
     gtcgatttcg gcgacgacgc gacgctcaag agcgtgctgc gctttgccgt ggagaacgcg       420
     ctcaagattc tcgacatcga gcggcggcgc ctcggcgaac tctcggacca atgtgcccgc       480
     tatccgctct ccgcggccaa gacgcgtcag gctctgcaat ttatcgacag cacgcaggcc       540
     atcctgaggg cggtgcagcc gcggctctaa                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page