(data stored in ACNUC7421 zone)

EMBL: CP001349.PE395

CP001349.PE395       Location/Qualifiers
FT   CDS_pept        452077..453345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0405"
FT                   /product="membrane-fusion protein"
FT                   /note="KEGG: met:M446_0093 membrane-fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55447"
FT                   /db_xref="GOA:B8IB54"
FT                   /db_xref="InterPro:IPR022275"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB54"
FT                   /inference="similar to AA sequence:KEGG:M446_0093"
FT                   /protein_id="ACL55447.1"
FT                   /translation="MSPSPQRTFRAISLERASSPEQLDHLVRITKPADWILGAVIALLL
FT                   TTALTWSVVGRIPTRAAGEGILVSVGGRVVDAVSATAGRLATIEVAVGDRVAQGQTVAR
FT                   IAQTEIEQRYRNAVEVHREREREHTTLKAKTESELAAKARNFAKLEEAFTQIVQATEQR
FT                   IDYLAGEVKNLEMLLSKGITTRRIVEDRRRELTDARQRRQDAQNEVLKLRSQKADLETQ
FT                   RERDIQDSEFRLNEARRQMEQLAGELGRNTQVTSPIEGRVLEIKVSPGSVLSVGTPVIA
FT                   VETEGKALEAVIYIPADKGKAVKPGMETRLEPSTVKREEFGTLVGTVVSISDFPITPQG
FT                   MAAVLHNDSLVTRFSQEGAPYAALVRLQPDPGTASGYRWAVGKGPDLRLTSGTLTKAEI
FT                   TTREQRPLDLVVPMLKRLTGLAG"
     atgagtccat ccccgcagcg gaccttccgg gcgatttcgc tggaacgtgc ctcgtcgccc        60
     gaacagctcg atcatcttgt ccgcatcacc aagcccgccg actggatcct gggcgcggtc       120
     atcgcccttc tgctcacgac ggccctgacc tggagcgtcg tcgggcgtat cccgacccgc       180
     gcggcgggcg agggcattct cgtgagcgtg ggcgggcgag tggtcgatgc ggtctcggcc       240
     acggcaggcc gcctcgcgac gatcgaggtc gcggtcggcg accgcgtcgc acagggccag       300
     acggtcgccc gcatcgccca gaccgagatc gagcagcgct accgcaacgc cgtggaggtc       360
     caccgcgagc gtgagcgcga gcacaccacg ctcaaggcca agaccgagag cgagctcgcc       420
     gccaaggcac gcaacttcgc caagctggag gaggccttca cccagatcgt ccaggccacg       480
     gagcagcgca tcgactatct ggccggcgag gtgaagaacc tggagatgct gctctccaag       540
     ggcatcacca cccgccggat cgtcgaggac cggcggcgcg agctcaccga cgcgcgccag       600
     cgccgccagg acgcccagaa cgaggtgctc aagctgcgct cgcagaaggc cgacctcgaa       660
     acccagcgcg agcgcgacat ccaagattcg gagttccgcc tcaacgaggc gcgccgccag       720
     atggagcagc ttgccggcga actcgggcgc aacacgcagg tgacgagccc gatcgaggga       780
     cgcgtcctcg agatcaaggt ctcgccgggc tcggtcctct ccgtcggcac gccggtgatc       840
     gcggtcgaga ccgagggcaa ggcgctggag gccgtgatct acatcccggc cgacaagggc       900
     aaggccgtga agcccggcat ggagacccgc ctcgagccga gcacggtcaa gcgggaggag       960
     ttcggaaccc tcgtcgggac ggtggtgtcg atctccgact tcccgatcac gccacagggc      1020
     atggccgcgg tgctgcacaa cgacagccta gtcacccgct tctcgcagga gggggcgccc      1080
     tacgccgctc tcgtgcgcct ccagccggat ccgggcacag cgagcggcta ccgctgggcg      1140
     gtcggcaagg ggccggacct gcggctcacc agcggcacgc tcaccaaggc cgagatcacc      1200
     acccgcgagc agcgccccct cgatctcgtg gtgccgatgc tcaagcgcct gaccggcctc      1260
     gccgggtag                                                              1269
//

If you have problems or comments...

PBIL Back to PBIL home page